Journal of Bacteriology, December 1998, p. 6440-6445, Vol. 180, No. 24
0021-9193/98/$04.00+0
Copyright © 1998, American Society for Microbiology. All rights reserved.

Department of Microbiology, Iowa State University, Ames, Iowa 50011,1 and Department of Genetics and Cell Biology, University of Minnesota, St. Paul, Minnesota 551082
Received 20 May 1998/Accepted 28 September 1998
| |
ABSTRACT |
|---|
|
|
|---|
P460 cytochromes catalyze the oxidation of hydroxylamine to nitrite. They have been isolated from the ammonia-oxidizing bacterium Nitrosomonas europaea (R. H. Erickson and A. B. Hooper, Biochim. Biophys. Acta 275:231-244, 1972) and the methane-oxidizing bacterium Methylococcus capsulatus Bath (J. A. Zahn et al., J. Bacteriol. 176:5879-5887, 1994). A degenerate oligonucleotide probe was synthesized based on the N-terminal amino acid sequence of cytochrome P460 and used to identify a DNA fragment from M. capsulatus Bath that contains cyp, the gene encoding cytochrome P460. cyp is part of a gene cluster that contains three open reading frames (ORFs), the first predicted to encode a 59,000-Da membrane-bound polypeptide, the second predicted to encode a 12,000-Da periplasmic protein, and the third (cyp) encoding cytochrome P460. The products of the first two ORFs have no apparent similarity to any proteins in the GenBank database. The overall sequence similarity of the P460 cytochromes from M. capsulatus Bath and N. europaea was low (24.3% of residues identical), although short regions of conserved residues are present in the two proteins. Both cytochromes have a C-terminal, c-heme binding motif (CXXCH) and a conserved lysine residue (K61) that may provide an additional covalent cross-link to the heme (D. M. Arciero and A. B. Hooper, FEBS Lett. 410:457-460, 1997). Gene probing using cyp indicated that a cytochrome P460 similar to that from M. capsulatus Bath may be present in the type II methanotrophs Methylosinus trichosporium OB3b and Methylocystis parvus OBBP but not in the type I methanotrophs Methylobacter marinus A45, Methylomicrobium albus BG8, and Methylomonas sp. strains MN and MM2. Immunoblot analysis with antibodies against cytochrome P460 from M. capsulatus Bath indicated that the expression level of cytochrome P460 was not affected either by expression of the two different methane monooxygenases or by addition of ammonia to the culture medium.
| |
INTRODUCTION |
|---|
|
|
|---|
Autotrophic, nitrifying bacteria and methanotrophs can both oxidize ammonia to nitrite in a two-step process. In the first, energy-dependent step, ammonia is oxidized to hydroxylamine. In methanotrophs, this reaction is catalyzed by a membrane-bound methane monooxygenase (pMMO) and, in certain species, if copper is limiting, by a separate, soluble methane monooxygenase (sMMO) (7, 30, 33, 35). In autotrophic nitrifying bacteria, ammonia is oxidized to hydroxylamine by ammonia monooxygenase, a membrane-bound enzyme with considerable similarity in catalytic properties and primary structure to the pMMO of methanotrophs (7, 9, 11, 18, 21, 26, 34, 42). In the second step, hydroxylamine is oxidized to nitrite, releasing four electrons. In the nitrifying bacterium Nitrosomonas europaea, the oxidation of hydroxylamine is catalyzed by two periplasmic cytochromes, hydroxylamine oxidoreductase (HAO) and cytochrome P460 (8, 12, 21, 32). HAO is considerably more abundant than cytochrome P460 and supports a much higher rate of hydroxyamine oxidation than cytochrome P460 in vitro (12, 21, 28). HAO is a complex enzyme, consisting of three 63-kDa subunits, each of which contain seven c hemes and a unique heme P460 chromophore (3, 4, 21, 22). The heme P460 of HAO is named for its Soret absorbance maximum in the reduced state and constitutes the active site (20). Cytochrome P460 is considerably smaller, consisting of a dimer of 18-kDa subunits, each of which contains a single heme, also known as heme P460 (8, 14, 21, 28). The heme P460 chromophores of HAO and cytochrome P460 have quite similar spectral properties (2, 4, 21), and both consist of a modified c heme that is covalently attached to the polypeptide by three linkages, two of which are thioether linkages to cysteine residues of the polypeptide. However, the third covalent linkage between the polypeptide and the heme P460 in the two cytochromes differ in nature; the heme P460 in HAO is linked covalently to a tyrosine residue (3, 22), while in cytochrome P460 the heme appears to be linked to a lysine residue (5). It is interesting that despite the similarities of the P460 hemes of HAO and cytochrome P460, the two cytochromes have no similarity in amino acid sequence, apart from the presence of c-heme binding site motifs (CXXCH) (8, 32).
In the methanotroph Methylococcus capsulatus Bath, cytochrome P460 is responsible for the oxidation of hydroxlyamine to nitrite (43). Because of its similarities in size, subunit composition, and electron paramagnetic resonance spectra to the cytochrome P460 of N. europaea, the M. capsulatus Bath cytochrome was also named cytochrome P460 (43). In this study, we examined the gene encoding cytochrome P460 from M. capsulatus Bath and compared the deduced amino acid sequence to that of cytochrome P460 from N. europaea in an attempt to define additional characteristics of this unique class of cytochromes. The amino acid sequence of the M. capsulatus Bath cytochrome P460 indicates that the cytochromes P460 of nitrifiers and methanotrophs have a common, though very distant, ancestral form and may share important structural features.
| |
MATERIALS AND METHODS |
|---|
|
|
|---|
Culture conditions and protein purification. Culture conditions for N. europaea, M. capsulatus Bath, Methylosinus trichosporium OB3b, Methylocystis parvus OBBP, Methylobacter marinus A45, Methylomicrobium albus BG8, and Methylomonas sp. strains MN and MM2 were described previously (10, 26, 42, 43).
The potential induction of cytochrome P460 in M. capsulatus Bath by ammonia was carried out in a 5-liter Bioflow 3000 (New Brunswick Scientific, New Brunswick, N.J.) fermentor/chemostat. Cells were cultured in nitrate mineral salts medium at 42°C (40) under an atmosphere of 5% methane-95% (vol/vol) air. The cells were cultured to a wet cell density of 2 g/liter and were induced by the addition of 9.4 mM (NH4)Cl2 (40). An oxygen saturation level of 50% ± 3% and pH (7.0 ± 0.1) was controlled following the addition of ammonia. After the addition of ammonia, 35-ml cell samples were taken every 15 min for 4 h. Cytochrome P460 was isolated by the method of Zahn et al. (43). Before N-terminal amino acid sequencing of cytochrome P460, samples were applied to a 6- by 10- by 0.5-cm preparative sodium dodecyl sulfate (SDS)-containing denaturing gel (25). After electrophoresis, the gel was briefly soaked in transfer buffer (25 mM Tris [pH 8.3], 193 mM glycine, 20% methanol, 0.05% SDS) and transferred to a polyvinylidene difluoride membrane, using a Panther semidry electrophoretic blotter (Owl Scientific Inc., Woburn, Mass.) at 10 V and 400 m A, for 1 h. The greenish cytochrome P460 band was cut out of the membrane and sequenced by Edman degradation in an Applied Biosciences 477A protein sequencer coupled to a 120A analyzer. HAO was purified from N. europaea as described by Arciero and Hooper (3).DNA methods. Genomic DNAs from M. capsulatus Bath and N. europaea were isolated by the methods of Ausubel et al. (6) and McTavish et al. (26), respectively. Genomic DNA from M. trichosporium OB3b, M. parvus OBBP, M. marinus A45, M. albus BG8, and Methylomonas sp. strains MN and MM2 was isolated as described previously (15). Plasmid DNA was isolated by the alkaline lysis method (31).
Digestion of DNA with restriction endonucleases, dephosphorylation with calf alkaline phosphatase, and ligation with T4 DNA ligase were performed as directed by the manufacturers (Life Technologies, Gaithersburg, Md., and Promega Corporation, Madison, Wis.). Agarose gel electrophoresis of restriction fragments was conducted by standard methods (31). Restriction fragments in gels were transferred to positively charged nylon membranes (Magna Charge Plus; MSI, Wesboro, Mass.) after denaturation by capillary transfer (31). Degenerate oligonucleotide probes were prepared by the Iowa State University DNA Sequencing Facility and 5' end labeled with [32P]ATP by using T4 polynucleotide kinase (31). Longer, double-stranded probes were prepared by the random hexamer priming technique (15), using a Prime-A-Gene kit (Promega). To hybridize Southern blots with degenerate oligonucleotide probes, membranes were prehybridized for 1 h and hybridized overnight in 6× SSPE (1× SSPE is 0.18 M NaCl, 10 mM NaH2PO4, and 1 mM EDTA [pH 7.7])-1× Denhardt's solution-0.5% SDS-10% polyethylene glycol (8,000 Da) at 42°C (31). To hybridize Southern blots with longer probes, membranes were prehybridized for 1 h and hybridized overnight in 6× SSPE-0.5% BLOTTO (31)-0.5% SDS at 55°C. A clone bank of M. capsulatus Bath genomic fragments was prepared in the cosmid vector PVK102 (24). The vector was digested with SalI and treated with calf intestinal alkaline phosphatase. Partial and complete XhoI digests of M. capsulatus Bath genomic DNA were combined and size fractionated by sucrose density gradient ultracentrifugation (1) to yield fragments greater than 15 kbp. Approximately 9 µg of M. capsulatus Bath XhoI fragments was ligated to 3 µg of phosphatase-treated vector. Approximately 4 µg of the ligation mixture was packaged into phage capsids by a the Pack-A-Gene kit (Stratagene, La Jolla, Calif.) and used to infect Escherichia coli DH5
(Life Technologies). The resulting colonies were
selected for tetracycline resistance and kanamycin susceptibility,
transferred to microtiter plates, and imprinted on nylon membranes.
Colonies were lysed in situ on nylon membranes, and DNA was denatured
and fixed as described by Sambrook et al. (31) prior to
hybridization with oligonucleotide probes. Restriction fragments of
cosmid clones were subcloned into the plasmid vector pBluescript KS
(Stratagene) for sequencing. Universal and custom oligonucleotide
primers were used to sequence double-stranded plasmid DNA by the DNA
Sequencing Facility at Iowa State University.
RNA methods.
Total RNA was isolated from a late-log-phase
culture of M. capsulatus Bath by a modification of the
method of Waechter-Brulla et al. (37). Ten milliliters of
culture was centrifuged briefly at 3,000 × g and
5°C, and the cell pellet was resuspended in 3.3 ml of TE buffer (10 mM Tris-HCl [pH 7.5], 1 mM EDTA). Hot lysis buffer (20 mM Tris-HCl
[pH 7.5], 2% [wt/vol] SDS, 20 mM NaEDTA, 200 mM NaCl) was added,
and the mixture was incubated for 3 min at 70°C. The solution was
then extracted three times with phenol (pH 4.3) at 70°C, once with
phenol-chloroform-isoamyl alcohol (25:24:1, pH 7.5) at 20°C, and once
with chloroform-isoamyl alcohol (24:1) at 20°C. RNA was precipitated
by addition of 1/10 volume of 3.0 M sodium acetate (pH 4.0) and 2 volumes of ethanol and incubation for over 12 h at
20°C; the
pellet was resuspended in water with 0.1 M NaEDTA.
Preparation of antibodies against cytochrome P460 and HAO. Antiserum against cytochrome P460 was raised in one New Zealand White rabbit by Animal Pharm Services, Inc. (Healdsburg, Calif.). Immunoglobin G was purified from the serum by using immobilized protein A (Pharmacia Biotech) according to the manufacturer's instructions. The cytochrome P460 antibody fraction was purified from the immunoglobin G fraction by using immobilized cytochrome P460 bound to a 1-ml HiTrap affinity column as instructed by manufacturer (Pharmacia Biotech).
Antiserum against HAO from N. europaea was raised as previously described (42). The HAO antibody fraction was purified from the serum by using immobilized HAO as described above.SDS-polyacrylamide gel electrophoresis and immunoblot analysis. Electrophoresis was performed on SDS-containing denaturing gels by the method of Laemmli (25) or on Tricine gels as specified by the manufacturer (Novex Experimental Technologies, San Diego, Calif.). Gels were stained for total protein with Coomassie brilliant blue R or blotted for immunoassays.
Proteins were blotted onto nitrocellulose by using a Panther semidry electrophoretic blotter (Owl Scientific) according to the manufacturer's directions. Following treatment with serum raised against purified protein, filter-bound antibodies were detected by an alkaline phosphatase assay as instructed by the manufacturer (Bio-Rad Laboratories, Hercules, Calif.).Nucleotide sequence accession number. DNA sequences were deposited in GenBank under accession no. AF091435.
| |
RESULTS |
|---|
|
|
|---|
Cloning and sequencing the cypA gene cluster of M. capsulatus. The N-terminal amino acid sequence of cytochrome P460 from M. capsulatus, derived by Edman degradation, was EPAAAPNGISLPAGYKDWKMIGVSSRIEQNNLRAILGNDIAVKAAREGRTHPWPDGAIL. This sequence agrees with the much shorter sequence published earlier by Zahn et al. (43) and was used to synthesize a degenerate oligonucleotide probe with the sequence 5'-GGI-TAY-AAR-GAY-TGG-AAR-ATG-ATI-GG-3', where I represents inosine and Y and R represent mixtures of pyrimidines and mixtures of purines, respectively. The probe was used to screen 2,300 cosmid clones, yielding a single clone that hybridized to the probe. An approximately 6-kbp PstI fragment of this clone was subcloned and sequenced (Fig. 1 and 2).
|
|
|
Transcriptional start site mapping.
A Northern blot of total
RNA from M. capsulatus Bath, probed with the 442-base
SacII-HindIII fragment containing the cloned cyp gene, indicated that the cyp transcript was
about 950 bases long (Fig. 4). The 5' end
of the cyp transcript was mapped by primer extension using
primer TXCYP, the reverse complement of bases 2380 to 2401 (Fig. 2).
Two adjacent transcriptional start sites were indicated at bases 2340 and 2341 (Fig. 5). No
35 and
10
70 consensus promoter sequences are located near the
cyp transcriptional start sites. However, sequences with a
weak resemblance to
24 and
12
54 consensus promoter
sequences are located 15 bases upstream of the transcriptional start
site (Fig. 2). The 5' end of the transcript from ORF1 (and possibly
ORF2) was also mapped by using three primers: TXORA, the reverse
complement of bases 284 to 302; TXORB, the reverse complement of
bases 181 to 199; and TXORC, the reverse complement of bases 105 to
121 (Fig. 2). Only TXORC yielded a major primer extension product,
starting at base 47 (Fig. 5). Weak matches to E. coli
70
35 and
10 consensus promoter sequences are found
at bases 6 to 11 and 29 to 34, respectively (Fig. 2).
|
|
Southern blots. To determine if close homologues to the cyp gene of M. capsulatus Bath might exist in other species of methanotrophs, genomic Southern blots of M. trichosporium OB3b, M. parvus OBBP, M. marinus A45, M. albus BG8, and Methylomonas sp. strains MN and MM2 were probed with a 442-base SacII-HindIII fragment of the cloned M. capsulatus Bath cyp gene (Fig. 6). In addition to hybridizing with M. capsulatus Bath restriction fragments, the cyp probe hybridized relatively strongly to single restriction fragments of M. trichosporium OB3b DNA and much more weakly to a single restriction fragment of M. parvus OBBP DNA. No hybridization of the M. capsulatus Bath cyp probe to the other methanotrophs was observed.
|
Immunoblotting. Antisera to cytochrome P460 from M. capsulatus Bath and to HAO from N. europaea were used in immunoblotting experiments to determine if homologous proteins exist in selected methanotrophs and N. europaea. Except for cross-reactivity with a 16,000-Da polypeptide in cell extracts from M. capsulatus Bath, none of the polypeptides from whole-cell extracts from N. europaea, M. trichosporium OB3b, M. parvus OBBP, M. albus BG8, and Methylomonas sp. strains MN, and MM2 showed cross-reactivity to cytochrome P460 antiserum.
Regulation. Ammonia induction experiments showed that the concentration of cytochrome P460 polypeptide remained constant over a 4-h observation period following the addition of 5 mM ammonia, although induction of a high-molecular-mass c-type cytochrome (10) was observed (Fig. 7). Repeated addition of ammonia also failed to alter the cellular concentration of cytochrome P460. In addition, the antiserum to cytochrome P460 was used in immunoblotting experiments to show that the cellular concentration of cytochrome P460 did not change with expression of the different MMOs (results not shown).
|
Oxidation of ammonia to nitrite. Production of nitrite following ammonia addition to early-stationary-phase cultures of M. trichosporium OB3b, M. parvus OBBP, M. albus BG8, and Methylomonas sp. strains MN and MM2 was also examined. Nitrite production was observed in stoichiometric amounts to the ammonia oxidized in all strains tested except Methylomonas sp. strains MN and MM2.
| |
DISCUSSION |
|---|
|
|
|---|
The primary amino acid sequences of cytochromes P460 from N. europaea and M. capsulatus Bath are dissimilar, despite the similarity in overall amino acid composition noted by Zahn et al. (43). However, the presence of a small number of conserved amino acid residues throughout both cytochromes suggests derivation from a common ancestral form. Among these conserved residues are the C-terminal c-heme binding motif (ECXXCH) and a lysine residue (K61 in M. capsulatus Bath) which, in N. europaea, is believed to form a covalent cross-link to the heme (5).
The placement of the gene encoding cytochrome P460 was different in M. capsulatus Bath than in N. europaea. In N. europaea, cyp is not located near any other ORFs (8). In M. capsulatus Bath, cyp is part of a gene cluster with two other ORFs but appears to be transcribed separately. Neither of these ORFs encodes cytochrome c', the likely electron acceptor of cytochrome P460 (44).
Cytochrome P460 appears to be constitutively expressed in M. capsulatus Bath. Ammonia induction experiments showed that the concentration of cytochrome P460 polypeptide remained constant over a 4-h observation period following the addition of ammonia. In addition, the polypeptide concentrations in extracts from cells expressing the pMMO and from cells expressing the sMMO were identical.
Southern blots indicated that a cytochrome P460 similar to that of M. capsulatus Bath (a type X methanotroph) probably exists in both type II methanotrophs tested, M. parvus OBBP and M. trichosporium OB3b, but not in any of the type I methanotrophs tested, M. marinus A45, M. albus BG8, and Methylomonas sp. strains MN and MM2 (17, 18). It is not known if a P460 cytochrome, distinct from both the N. europaea and M. capsulatus Bath P460 cytochromes, exists in the type I methanotrophs. Antisera to cytochrome P460 from M. capsulatus Bath did not cross-react with any of the other methanotrophs tested in immunoblot experiments. The results suggest high sequence variability between the methanotrophs tested for potential cytochromes P460, even among methanotrophs which appear to have cyp homologues.
Results of Southern blot and immunoblot experiments using a gene probe and antisera to HAO, respectively, were also negative for all methanotrophs tested. We do not know whether methanotrophs such as M. albus BG8 that show negative hybridization or cross-reactivity to both cytochrome P460 and HAO gene probes or antibodies, respectively, and oxidize ammonia to nitrite contain a heme P460-containing enzyme or a non-P460-containing HAO (22, 37). In addition, the existence of methanotrophs such as Methylomonas sp. strains MN and MM2 that show negative hybridization or cross-reactivity to both cytochrome P460 and HAO gene probes or antibodies and do not oxidize ammonia to nitrite raises the question of whether all strains of methanotrophs can oxidize ammonia to nitrite.
The presence of a gene similar to cyp of M. capsulatus Bath in type II but not type I methanotrophs is
somewhat puzzling when one considers that M. capsulatus
Bath, which belongs to the
subfamily of the proteobacteria, is more
closely related to the type I methanotrophs, which also belong to the
subfamily, than to the type II methanotrophs, which belong to the
subfamily (17). The presence of a gene similar to
cyp of M. capsulatus Bath in type II but not type
I methanotrophs is even more surprising because the sequence of the
27,000-Da subunit of pMMO from M. capsulatus Bath is
considerably more similar to those from the type I methanotrophs than
to those from type II methanotrophs (19). The presence of
genes encoding similar P460 cytochromes in M. capsulatus
Bath and type II methanotrophs suggests that one or both of these
groups may have acquired the cyp gene by horizontal gene transfer.
| |
ACKNOWLEDGMENTS |
|---|
We thank B. Voss (Iowa State University) and J. Nott (Iowa State University Protein Facility) for technical assistance.
This work was supported by Department of Energy grant 02-96ER20237 (A.A.D.).
| |
FOOTNOTES |
|---|
* Corresponding author. Mailing address: Department of Microbiology, Iowa State University, 207 Science Building I, Ames, IA 50011-3211. Phone: (515) 294-2944. Fax: (515) 294-6019. E-mail: aland{at}iastate.edu.
Journal paper J-18098 from the Agriculture and Home Economics
Experiment Station, Ames, Iowa (project 3252).
Present address: Natural Products Research and Development, Lilly
Research Laboratories, Eli Lilly and Company, Indianapolis, IN 46285.
| |
REFERENCES |
|---|
|
|
|---|
| 1. | Altschul, S. F., W. Gish, W. Miller, E. W. Myers, and D. J. Lipman. 1990. Basic local alignment search tool. J. Mol. Biol. 215:403-410[Medline]. |
| 2. | Andersson, K. K., G. T. Babcock, and A. B. Hooper. 1991. P460 of hydroxylamine oxidoreductase of Nitrosomonas europaea: Soret resonance Raman evidence for a novel heme-like structure. Biochem. Biophys. Res. Commun. 174:358-363[Medline]. |
| 3. |
Arciero, D. M., and A. B. Hooper.
1993.
Hydroxylamine oxidoreductase from Nitrosomonas europaea is a multimer of an octa-heme subunit.
J. Biol. Chem.
268:14645-14654 |
| 4. | Arciero, D. M., A. B. Hooper, M. Cai, and R. Timkovitch. 1993. Evidence for the structure of the active site in hydroxylamine oxidoreductase. Biochemistry 32:9370-9378[Medline]. |
| 5. | Arciero, D. M., and A. B. Hooper. 1997. Evidence for a crosslink between c-heme and a lysine residue in cytochrome P460 of Nitrosomonas europaea. FEBS Lett. 410:457-460[Medline]. |
| 6. | Ausubel, F. M., R. Brent, R. E. Kingston, D. D. Moore, J. G. Seidman, J. A. Smith, and K. Struhl (ed.). 1987. Current protocols in molecular biology. Greene Press, New York, N.Y. |
| 7. |
Bédard, C., and R. Knowles.
1989.
Physiology, biochemistry, and specific inhibitors of CH4, NH4, and CO oxidation by methanotrophs and nitrifiers.
Microbiol. Rev.
53:68-84 |
| 8. | Bergmann, D. J., and A. B. Hooper. 1994. The primary structure of cytochrome P460 of Nitrosomonas europaea: the presence of a c-heme binding motif. FEBS Lett. 353:324-326[Medline]. |
| 9. | Bergmann, D. J., and A. B. Hooper. 1994. Sequence of the gene amoB which encodes the 46 kDa polypeptide of ammonia monooxygenase of Nitrosomonas europaea. Biochem. Biophys. Res. Commun. 204:759-762[Medline]. |
| 10. | Bergmann, D. J., J. A. Zahn, and A. A. DiSpirito. Unpublished results. |
| 11. | Dalton, H. 1977. Ammonia oxidation by the methane oxidizing bacterium Methylococcus capsulatus Bath. Arch. Microbiol. 144:273-279. |
| 12. | DiSpirito, A. A., R. L. Taaffe, and A. B. Hooper. 1985. Localization and concentration of hydroxylamine oxidoreductase and cytochromes c552, c554, cm552, cm553, and a in Nitrosomonas europaea. Biochim. Biophys. Acta 806:320-330. |
| 13. | DiSpirito, A. A., J. Gulledge, A. K. Shiemke, J. C. Murrell, M. E. Lidstrom, and C. L. Krema. 1992. Trichloroethylene oxidation by the membrane-associated methane monooxygenase in type I, type II, and type X methanotrophs. Biodegradation 2:151-164. |
| 14. | Erickson, R. H., and A. B. Hooper. 1972. Preliminary characterization of a variant CO binding heme protein from Nitrosomonas. Biochim. Biophys. Acta 275:231-244[Medline]. |
| 15. | Feinburg, A. P., and B. Vogelstein. 1983. A technique for radiolabeling DNA restriction endonuclease fragments to high specific activity. Anal. Biochem. 132:6-13[Medline]. |
| 16. |
Fulton, G. L.,
D. N. Nunn, and M. E. Lidstrom.
1984.
Molecular cloning of a malyl coenzyme A lyase gene from Pseudomonas sp. strain AM1, a facultative methylotroph.
J. Bacteriol.
160:718-723 |
| 17. | Hanson, R. S., B. J. Bratina, and G. A. Brusseau. 1993. Physiology and ecology of methylotrophic bacteria, p. 285-302. In J. C. Murrell, and D. P. Kelley (ed.), Microbial growth on C1 compounds. Intercept, Andover, England. |
| 18. |
Hanson, R. S., and T. E. Hanson.
1996.
Methanotrophic bacteria.
Microbiol. Rev.
60:439-471 |
| 19. | Holmes, A. J., A. Costello, M. E. Lidstrom, and J. C. Murrell. 1995. Evidence that the particulate methane monooxygenase and ammonia monooxygenase may be evolutionarily related. FEMS Microbiol. Lett. 132:230-208. |
| 20. | Hooper, A. B., and K. R. Terry. 1977. Hydroxylamine oxidoreductase from Nitrosomonas: inactivation by hydrogen peroxide. Biochemistry 16:455-459[Medline]. |
| 21. | Hooper, A. B., T. Vannelli, D. J. Bergmann, and D. M. Arciero. 1997. Enzymology of the oxidation of ammonia to nitrite by bacteria. Antonie Leeuwenhoek 71:59-67[Medline]. |
| 22. | Igarashi, N., H. Moriyama, T. Fujiwara, Y. Fukmori, and N. Tanaka. 1997. The 2.8 angstrom structure of hydroxylamine oxidoreductase from a nitrifying chemoautotrophic bacterium, Nitrosomonas europaea. Nat. Struct. Biol. 4:276-284[Medline]. |
| 23. | Jetten, M. S. M., P. J. de Bruijin, and G. Kuenen. 1997. Hydroxylamine metabolism in Pseudomonas PB16: involvement of a novel hydroxylamine oxidoreductase. Antonie Leeuwenhoek 71:69-74. |
| 24. | Knauf, V. C., and E. W. Nester. 1982. Wide host range cloning vectors: cosmid clone bank of Agrobacterium Ti plasmids. Plasmid 8:45-54[Medline]. |
| 25. | Laemmli, U. K. 1970. Cleavage of structural proteins during the assembly of the head of bacteriophage T4. Nature (London) 227:680-685[Medline]. |
| 26. |
McTavish, H.,
J. A. Fuchs, and A. B. Hooper.
1993.
Sequence of the gene coding for ammonia monooxygenase in Nitrosomonas europaea.
J. Bacteriol.
175:2436-2444 |
| 27. | Nielsen, A. K., K. Gerdes, H. Degn, and J. C. Murrell. 1996. Regulation of bacterial methane oxidation: transcription of the soluble methane monooxygenase operon of Methylococcus capsulatus (Bath) is repressed by copper ions. Microbiology 142:1289-1296[Abstract]. |
| 28. |
Numata, M.,
T. Saito,
T. Yamazaki,
Y. Fukumori, and T. Yamanaka.
1990.
Cytochrome P-460 of Nitrosomonas: further purification and further characterization.
J. Biochem.
108:1016-1021 |
| 29. | O'Neill, J. G., and J. F. Wilkinson. 1977. Oxidation of ammonia by methane-oxidizing bacteria and effects of ammonia on methane oxidation. J. Gen. Microbiol. 100:407-412. |
| 30. | Prior, S. D., and H. Dalton. 1985. The effect of copper ions on the membrane content and methane monooxygenase activity in methanol-grown cells of Methylococcus capsulatus (Bath). J. Gen. Microbiol. 131:155-163. |
| 31. | Sambrook, J., E. F. Fritsch, and T. Maniatis. 1989. Molecular cloning: a laboratory manual, 2nd ed. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. |
| 32. |
Sayavedra-Soto, L. A.,
N. G. Hommes, and D. J. Arp.
1994.
Characterization of the gene encoding hydroxylamine oxidoreductase in Nitrosomonas europaea.
J. Bacteriol.
176:504-510 |
| 33. | Scott, D., J. Brannan, and I. J. Higgins. 1981. The effect of growth conditions on intracytoplasmic membranes and methane monooxygenase activities in Methylosinus trichosporium OB3b. J. Gen. Microbiol. 125:63-72. |
| 34. |
Semrau, J. D.,
A. Chistoserdov,
J. Lebron,
A. Costello,
J. Davagnino,
E. Kenna,
A. Holms,
R. Finch,
J. C. Murrell, and M. E. Lidstrom.
1995.
Particulate methane monooxygenase genes in methanotrophs.
J. Bacteriol.
177:3071-3079 |
| 35. | Stanley, S. H., S. D. Prior, J. D. Leak, and H. Dalton. 1983. Copper stress underlines the fundamental change in intracellular location of methane mono-oxygenase in methane utilizing organisms: studies in batch and continuous cultures. Biotechnol. Lett. 5:487-492. |
| 36. | von Heijne, G. 1992. Membrane protein structure prediction, hydrophobicity analysis, and the positive inside rule. J. Mol. Biol. 225:487-494[Medline]. |
| 37. |
Waechter-Brulla, D.,
A. A. DiSpirito,
L. V. Chistoserdova, and M. E. Lidstrom.
1993.
Methanol oxidation genes in the marine methanotroph Methylomonas sp. strain A4.
J. Bacteriol.
175:3767-3775 |
| 38. | Wallar, B. J., and J. D. Lipscomb. 1996. Dioxygen activation by enzymes containing dinuclear non-heme iron clusters. Chem. Rev. 96:2625-2657[Medline]. |
| 39. | Wehrfritz, J. M., A. Reilly, S. Spiro, and D. J. Richarson. 1993. Purification of hydroxylamine oxidase from Thiosphaera pantotropha. FEBS Lett. 335:246-250[Medline]. |
| 40. | Whittenbury, R., and H. Dalton. 1981. The methylotrophic bacteria, p. 894-902. In M. P. Starr, H. G. Truper, A. Balows, and H. G. Schlegel (ed.), The prokaryotes, vol. I. Springer-Verlag, New York, N.Y. |
| 41. | Whittenbury, R., K. C. Phillips, and J. F. Wilkinson. 1970. Enrichment, isolation and some properties of methane-utilizing bacteria. J. Gen. Microbiol. 61:205-218[Medline]. |
| 42. |
Zahn, J. A., and A. A. DiSpirito.
1996.
The membrane-associated methane monooxygenase from Methylococcus capsulatus Bath.
J. Bacteriol.
178:1018-1029 |
| 43. |
Zahn, J. A.,
C. Duncan, and A. A. DiSpirito.
1994.
Oxidation of hydroxylamine by cytochrome P460 of the obligate methylotroph Methylococcus capsulatus Bath.
J. Bacteriol.
176:5879-5887 |
| 44. | Zahn, J. A., D. M. Arciero, A. B. Hooper, and A. A. DiSpirito. 1996. Cytochrome c' of Methylococcus capsulatus Bath. Eur. J. Biochem. 240:684-669[Medline]. |
This article has been cited by other articles:
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Appl. Environ. Microbiol. | Infect. Immun. | Eukaryot. Cell |
|---|---|---|
| Mol. Cell. Biol. | J. Virol. | Microbiol. Mol. Biol. Rev. |
| ALL ASM JOURNALS |