Previous Article | Next Article ![]()
J Bacteriol, April 1998, p. 1662-1672, Vol. 180, No. 7
Department of Biology, Georgia State
University, Atlanta, Georgia 30303
Received 9 July 1997/Accepted 26 January 1998
Secretion of the Escherichia coli toxin colicin V was
previously determined to be iron regulated via the Fur (ferric uptake regulator) protein, based on studies in fur mutants. The
iron dependence of transcription and expression of cvaA,
which encodes a transporter accessory protein, and cvi,
encoding the colicin V immunity protein, was assessed under conditions
of iron excess or depletion. Immunoblots showed that production of both
Cvi and CvaA is iron dependent. The iron-dependent transcriptional
start for cvaA identified by primer extension and S1
nuclease analysis, P1, lies 320 bp upstream of the translational start
and is associated with a newly identified Fur binding site.
Many bacterial plasmids carry
genetic elements that confer upon the host a selective advantage. One
of these is pColV-K30, a large low-copy-number plasmid which was
isolated from a pathogenic strain of Escherichia coli
(13, 33, 34). In addition to pathogenic traits such as serum
resistance (2), aerobactin iron uptake (35), and
enhanced epithelial adherence (8), pColV-K30 was found to
carry the determinants for production and secretion of the peptide
antibiotic colicin V (ColV), which is toxic for related strains of the
family Enterobacteriaceae.
The ColV genes were characterized from a 9.4-kb subcloned fragment of
plasmid pColV-K30 (12, 13). The four genes which are
essential for ColV production, secretion, and host immunity, reside
within 4.5 kb of this fragment and are arranged in two converging
operons (12, 13). The genes encoding a secretion accessory
protein, CvaA, which belongs to the membrane fusion protein family
(10), and the transporter, CvaB, which belongs to the ATP
binding cassette transporter family, are encoded in a single operon
(13, 14). The genes encoding the immunity protein Cvi and
toxin CvaC are encoded in the opposing operon (13, 14).
Unlike most colicin systems, the ColV secretion system does not appear
to be inducible by an SOS response (17). Secretion of ColV
was found to be regulated by iron via Fur (6, 14), similar
to pathogenic traits such as iron uptake and This study shows that the expression of both Cvi and CvaA is iron
regulated and identifies iron-regulated promoters of both the
cvaA and cvi genes. Transcription of
cvi occurs from the previously predicted promoter and
associated Fur binding site. However, for cvaA,
iron-dependent transcription does not occur from the previously suggested promoter and Fur box upstream of cvaA but instead
occurs from a promoter that lies more than 320 bp upstream of the
translational start codon and is associated with a new Fur binding site
identified in this study. The transcriptional activity from this
promoter can be induced up to 10-fold by iron depletion. However,
sequences downstream of the transcriptional start apparently modulate
such induction fivefold and down-regulate overall transcription
approximately fourfold. The deletion of sequences encompassing a long
stem-loop structure from the downstream sequences partially relieves
this down-regulation. In addition, the modulating properties of these sequences were further substantiated for the cvi promoter,
which is also regulated by iron. The results show that analogous
placement of the cvaA downstream sequences modulates
transcription from the cvi promoter in a manner similar to
that observed for cvaA. Sequences including the predicted
RNA secondary structure showed the greatest down-modulation. In
summary, this study identified the promoters responsible for
iron-dependent expression of both Cvi and CvaA and revealed that
transcription of cvaA is more complex than anticipated.
Bacterial strains and culture media.
The E. coli
strains used in this study were MC4100 (F Transformations and DNA manipulations.
Standard procedures
were used to transform E. coli and for DNA manipulations
(32). Plasmids were isolated from Qiagen (Chatsworth, Calif.) gels. Restriction enzymes, phage T4 DNA ligase, and T4 polynucleotide kinase were used as described by the manufacturers. DNA
fragments were purified from agarose gels by using the Qiaex gel
extraction protocol as recommended by the manufacturer (Qiagen). Oligonucleotide primers (Table 1) were
synthesized by the
0021-9193/98/$04.00+0
Copyright © 1998, American Society for Microbiology. All rights reserved.
Characterization of the cvaA
and cvi Promoters of the Colicin V Export System:
Iron-Dependent Transcription of cvaA Is Modulated by
Downstream Sequences
![]()
ABSTRACT
Top
Abstract
Introduction
Materials & Methods
Results
Discussion
References
-Galactosidase activity in transcriptional lacZ fusions
with the P1 promoter alone is higher than with downstream sequences
present and is induced 10-fold by iron depletion. Including immediate
downstream regions with P1 enhances activity from P1 even more but
reduces the induction by iron depletion fivefold. Including subsequent
downstream sequences, however, down-modulates overall transcription
from P1 almost fourfold. Deletion of a long stem-loop structure in this
region alleviates the down-modulation by increasing transcription,
indicating that the sequences or structure of this element may
contribute to this down-regulation. Characterization of the
cvi promoter by primer extension showed that it resides
where predicted, about 50 bp upstream of cvi associated
with a previously identified Fur binding site. The cvi
promoter is also inducible by iron depletion. The modulating sequences
from cvaA were placed downstream of the cvi promoter to test their effects in transcriptional fusions of the cvi promoter to lacZ. The fusion results showed
that these sequences also modulate transcription of the cvi
promoter in a manner similar to that of the cvaA promoter.
The potential for up- and down-regulation within the long untranslated
region downstream of the cvaA promoter suggests a novel
mechanism that fine-tunes expression of the colicin V secretion genes.
![]()
INTRODUCTION
Top
Abstract
Introduction
Materials & Methods
Results
Discussion
References
-hemolysin secretion.
Fur represses transcription of genes in the presence of iron by binding
promoters that contain a Fur box (4, 9). However, results of
initial studies suggested the possibility that the observed
iron-dependent ColV activity was partially due to iron-dependent
expression of the transporter and accessory proteins, CvaA and CvaB,
allowing increased secretion of the toxin under iron-poor inducible
conditions. In support of this, studies using translational
Mudlac fusions indicated that cvaB and
cvi were under iron control, in that they both exhibited
increased
-galactosidase activity with the addition of the iron
chelator, dipyridyl (14). Transcriptional regulation of
these operons by Fur was also suggested by previous sequence analysis
that identified two potential Fur boxes, previously termed iron
response elements; one was 179 bp upstream of the cvaA gene,
and the other was 50 bp upstream of the cvi gene
(14). These two Fur boxes presumably control transcription
from the promoters for the converging cvaA-cvaB and
cvi-cvaC operons, respectively.
![]()
MATERIALS AND METHODS
Top
Abstract
Introduction
Materials & Methods
Results
Discussion
References
lacU169 araD136 relA1 rpsL150 flbB5301 deoC7 ptsF25
thi-1) and DH5
[supE44
lacU169 (
80
lacZ
M15) hsdR17 recA1 endA1 gyrA96 thi-1 relA1]. DH5
was used for initial transformations.
Luria-Bertani medium (LB; 10 g of tryptone, 5 g of yeast
extract, and 10 g of NaCl per liter) was used for growth of
competent cells and growth of cells after transformation. TB (10 g of
tryptone and 8 g of NaCl per liter) was used for all growth
conditions unless otherwise noted, as is or with FeCl3 or
2,2'-dipyridyl added at the concentrations indicated. Ampicillin and
glucose were added at final concentrations of 100 µg/ml and 0.5%,
respectively. Cultures were grown in TB-ampicillin-glucose with or
without FeCl3 until specific times during the growth cycle, either FeCl3 or dipyridyl was added, and then growth
resumed for an additional 40 min before harvesting.
-cyanoethylphosphoramidite method with an ABI
381A or 392 DNA synthesizer (Applied Biosystems, Foster City, Calif.)
in the Biology Core Facility of Georgia State University. PCR was
performed with T4 DNA polymerase as described elsewhere
(27).
TABLE 1.
Oligonucleotides useda
Plasmids and plasmid constructions.
pHK11 obtained from
Roberto Kolter (Harvard Medical School, Boston, Mass.) was derived from
pBR322 with a 9.4-kb fragment from pColV-K30 of which a 4.5-kb segment
contains the cvaA, cvaB, cvi, and
cvaC genes in two converging operons (12).
Transcriptional fusions of cvaA sequences (ALZ-n)
upstream of the lacZ gene were constructed by PCR using 5'
primers with BamHI sites and 3' primers with a
HindIII site cloned into the same restriction sites of the transcriptional fusion vector pQF50 (11). The
cvi promoter was similarly cloned by PCR upstream of
lacZ into the 5'-SalI-BamHI-3' site
(ILZ-1). This construction was then used to place specific cvaA sequences immediately downstream of the cvi
promoter in the BamHI-HindIII site,
generating a cvi-cvaA hybrid transcriptional lacZ
fusion. Table 1 lists all of the primers and summarizes the
constructions; the cvaA, cvi, and
cvi-cvaA hybrid constructions are depicted in Fig. 5. Most
PCR fragments were generated by using pHK11 as the template. A
SmaI-SmaI fragment and an
AvaII-AvaII fragment of pHK11 were used for
cvaA sequences to construct ILZ-1-4 and ILZ-1-6,
respectively. The annealing temperature during PCR was 55°C. PCR
products were ethanol precipitated and digested with BamHI
and HindIII, then purified from agarose gels by using Qiaex, and cloned into the transcriptional lacZ fusion
vector pQF50 (11) that was similarly digested and purified.
Ligation was followed by transformation into E. coli DH5
.
Transformants were screened by plating onto LB-glucose supplemented
with ampicillin (100 µg/ml) and
5-bromo-4-chloro-3-indolyl-
-D-galactopyranoside (X-Gal;
50 µg/ml). Plasmid insertions were confirmed by restriction enzyme
analysis and then transformed into MC4100. Sequences were verified by
using PRISM Ready Reaction DyeDeoxy terminator cycle sequencing kit
(Applied Biosystems), carried out at the Georgia State University
Biology Core Facility.
RNA isolation. MC4100/pHK11 cells were grown in 1 liter of TB-ampicillin-glucose. The optical density at 600 nm (OD600) was monitored, and at mid-logarithmic (OD600 = 0.4), late logarithmic (OD600 = 0.8), and stationary (OD600 = 1.0) growth phases, either 0.1 mM FeCl3 or 0.1 mM 2,2'-dipyridyl was added to 100-ml aliquots. The cultures were grown for an additional 40 min to repress or induce iron/Fur-regulated transcription, after which the culture was chilled on ice and harvested at 10,000 × g for 5 min. RNA was purified as described previously (18).
Primer extension and DNA sequencing.
For primer extension,
21 µg of each purified RNA sample was denatured with formaldehyde as
described previously (18). Synthetic oligonucleotides A14
and A17, antisense to specific cvaA sequences, and ALZ-16
and ALZ-21, specific for cvi sequences (Table 1), were
labeled with [
-32P]ATP (Amersham, Arlington Heights,
Ill.) by using T4 polynucleotide kinase according to the
manufacturer's specifications. The labeled primers were purified by
using G-25 Micro-Select spin columns (5 Prime
3 Prime, Inc.,
Boulder, Colo.) and then used to prime the reverse transcription of the
RNA, using murine myeloblastosis virus reverse transcriptase (New
England Biolabs, Beverly, Mass.) or Superscript II reverse
transcriptase (Gibco BRL, Gaithersburg, Md.). Primer extension products
were purified by using a QIAquick nucleotide removal kit (Qiagen).
These products were run adjacent to the corresponding DNA sequence
ladder generated by primer A14, A17, A16, or A21 on a 6% Sequagel
polyacrylamide gel (National Diagnostics, Atlanta, Ga.). DNA sequencing
was performed with a Sequenase dideoxy sequencing kit and
[
-S35]dATP. Radiograms were visualized with a
phosphoimager (Fuji Medical Systems, Inc., Stamford, Conn.) or by
exposure to Hyperfilm-MP (Amersham) or Biomax MR film (Eastman Kodak
Co., Rochester, N.Y.).
S1 nuclease analysis.
The same RNA samples from logarithmic
phase cells that were purified and used as described above for primer
extensions were subjected to S1 nuclease analysis. Primers A14 and A17,
radiolabeled with [
-32P]ATP as described above, were
used to construct a DNA probe for annealing to the cvaA
transcript. Purified plasmid pHK11 was alkaline denatured and annealed
with labeled primer A14 or A17. DNA probes specific for the
cvaA promoter regions were synthesized with the Klenow
fragment of DNA polymerase (Promega, Madison, Wis.) and restricted with
EcoRV, located at
345. Probes with radioactivity of 50,000 cpm were used for annealing to 21 µg of RNA and then subjected to
digestion with S1 nuclease (Ambion, Austin, Tex.) as described by the
manufacturer. Undigested radiolabeled DNA was precipitated with ethanol
and then run on a 6% polyacrylamide gel adjacent to Superscript II A14
or A17 primer-extended samples and A14 or A17 DNA sequence ladders.
Western blot analysis and quantitation of CvaA. Approximately 40 µg of total protein for each sample was used for sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE)/Western blotting performed as described elsewhere (16), using purified CvaA-specific antibodies (19) and alkaline phosphatase-conjugated goat anti-rabbit immunoglobulin G as secondary antibodies. The immunoprobed proteins were detected by using 2,2'-di-p-nitrophenyl- 5,5'-diphenyl-D,D'[3,3'-dimethoxy-4,4'-diphenylene] ditetrazolium chloride and 5-bromo-4-chloro-3-indolyl phosphate as the substrate. CvaA bands detected by Western blotting were quantified with the PDI Image Analyzing System (Protein Databases Inc., Huntington Station, N.Y.).
Western blot analysis of Cvi. Antibodies to Cvi were generated by using a synthetic peptide of the C-terminal 26 amino acids predicted for Cvi (CYFVGDNYYSISDKIKRRSYENSDSKA) combined with Freund's adjuvant and inoculated into rabbits according to standard protocols (16). Serum produced specific reactions to Cvi protein in MC4100/pHK11 but not in MC4100/pLY11 with cvaA and cvaB only (data not shown) was collected postinoculation. Although nonspecific bands were minimal, the serum was treated twice with MC4100 acetone powder (16). The treated Cvi serum was diluted 1:2,000 for immunoblotting. Approximately 40 µg of total protein of cell samples of MC4100 alone or of MC4100/pHK11 repressed with 0.1 mM FeCl3 or induced with 0.1 mM 2,2'-dipyridyl at an OD600 of 0.4 for 40 min was used for SDS-PAGE/Western blotting performed as described previously (16). The immunoblot was treated with labeled secondary antibodies and developed as described for CvaA above.
-Galactosidase assays.
MC4100 cells containing
lacZ promoter fusion plasmids were grown overnight in 2 ml
TB-ampicillin-glucose with 0.05 mM FeCl3. Overnight
cultures were diluted 1:20 to an OD600 of approximately 0.1 in 3 ml TB-ampicillin-glucose with 0.05 mM FeCl3 unless
otherwise noted. At mid-logarithmic phase, (OD600 = ~0.4), 1.5 ml of cells was induced with 0.1 mM 2,2'-dipyridyl. After
40 min of growth in either FeCl3 or dipyridyl, cells were
placed on ice, permeabilized, and then assayed in duplicate for
-galactosidase activity as described elsewhere (26).
Chemicals and reagents. All chemicals and reagents were from Sigma (St. Louis, Mo.) except where indicated otherwise. All DNA-modifying enzymes were from Boehringer (Indianapolis, Ind.) unless noted otherwise.
Oligonucleotide synthesis. All oligonucleotides used for primer extensions and PCR for cloning were constructed in the Georgia State University Biology Department Core Facility.
| |
RESULTS |
|---|
|
|
|---|
Iron dependence of CvaA and Cvi production in immunoblots. Previous studies have shown that ColV production is under iron regulation. Presumably, promoters associated with Fur binding sites identified upstream of the cvaA and cvi genes of the two converging ColV operons are responsible for iron-regulated production of the ColV proteins (see Fig. 3A). To confirm that CvaA and Cvi are also iron regulated, immunoblot analyses were used to determine the levels of CvaA and Cvi produced under different iron conditions. CvaA antibodies were used for immunoblotting to determine the iron and growth phase dependence of CvaA synthesis in total cell samples collected at mid-logarithmic, late logarithmic, and stationary phases of growth after the addition of iron or dipyridyl. Dipyridyl enhances transcription by alleviating Fur repression, resulting in transcriptional expression of genes subject to regulation by Fur and/or iron. Immunoblotting and quantification of the CvaA bands showed that low levels of CvaA is produced throughout the growth cycle even in the presence of iron. This finding indicates that CvaA is not completely repressed by iron and is expressed constitutively at low levels in the presence of iron (Fig. 1A). Under conditions where iron is depleted by dipyridyl, CvaA production is increased in the log phases of growth. However, in the stationary phase, dipyridyl no longer induces production of CvaA and a basal level is exhibited (Fig. 1A). The stationary-phase levels of CvaA with dipyridyl are similar to the basal levels observed with iron present. The maximum induction of CvaA observed in the late logarithmic phase compared to levels with iron is about fivefold (Fig. 1A). Therefore, it appears that the production of CvaA is repressed by iron levels and induced by iron depletion except in the stationary phase of growth.
|
Identification of the ColV promoters by primer extension
analyses.
To determine the promoter locations and transcriptional
regulation of the cvaA and cvi genes, primer
extension assays were performed on total RNA isolated from MC4100/pHK11
cells grown in TB containing either FeCl3 or 2,2'-dipyridyl
at time points corresponding to mid-logarithmic, late logarithmic, and
stationary growth phases. These RNA samples correspond to the cell
samples used for Fig. 1A. A promoter and Fur box, FB-I (see Fig. 3B), for iron-dependent transcription of cvi have been predicted
from DNA sequence analysis (14). However, their location and
iron dependence have not been verified. The transcriptional start for the cvi gene was mapped by using a primer (A21) antisense to
the sequence immediately downstream of the translational start
identified for cvaC (12, 13). The primer specific
for cvaC was used since cvaC is downstream of
cvi and presumably cotranscribed with cvi and
because the two genes are separated by only 214 bp. Primer extensions
revealed a single band which is present in all samples throughout the
growth cycle and is reduced with iron and increased by iron depletion
especially in the logarithmic phase (Fig.
2A). The band representing the
transcriptional start for cvi was mapped more closely by
using primer A16 immediately downstream of the cvi
translational start in primer extensions of the mid-log-phase samples.
Three closely spaced bands present in samples induced with dipyridyl
could represent the transcriptional start for cvi (Fig. 2A,
box). The strongest of the three bands was chosen as the +1 site,
although all are close enough to utilize the same promoter elements.
The promoter region for cvi is shown in Fig. 3C. Mapping the cvi
transcriptional start from primer extensions shows that it is only 40 bp upstream of its translational start. The possible
10 and
35
promoter elements are indicated and correspond well to the +1 band
(Fig. 3C). The
10 elements resides within the Fur binding site (FB-I)
(Fig. 3B) identified previously for cvi (14).
|
|
102. Figure 3D shows the entire promoter region upstream of
cvaA and indicates the location of the transcriptional start site (+1), the new promoter predicted for the +1 site, FB elements, and
the annealing location of the primers.
Transcription indicated by the cvaA primer extensions is not
quite consistent with immunoblot analyses (Fig. 1), since maximal iron
depletion-dependent induction in primer extensions occurs in the
mid-log phase and in immunoblots occurs in the late-log phase. This
variation could be due to a delay between transcription and
translation. It is also possible that CvaB, which is present in cell
samples used for immunoblots, may contribute to this difference since
evidence has indicated that CvaA and CvaB stabilize each other
(19). The production of CvaB may stabilize CvaA and allow it
to accumulate over time.
Since multiple bands were present in the initial primer extension
assays for cvaA additional assays were performed to verify that P1 was the only transcriptional start. Superscript II reverse transcriptase reportedly yields a greater percentage of full-length transcripts and may more effectively read through secondary structures within RNA transcripts, known to cause artifactual primer extension bands. Therefore, it was used for primer extension of the same mid-log-phase RNA samples as used for the assays shown in Fig. 2A and
B. These RNA samples were also subjected to S1 nuclease analysis to map
the 5' start of the cvaA transcript. Primer A14 was used for
primer extension, and a probe synthesized by using primer A14 was used
for the S1 nuclease protection assays. The lower bands were reduced in
primer extensions with Superscript II (Fig. 2C, lanes 1 and 2).
Furthermore, the S1 protection assay reveals that P1 is the only band
present, indicating that all other bands are artifacts of primer
extension probably resulting from secondary structures in the RNA (Fig.
2C, lanes 3 and 4).
Primer extension and S1 assays were also performed with primer A17
(Fig. 2D). Here primer extension also maps the start site at G-102
(Fig. 2D, lanes 1 and 2). However, for the S1 nuclease assays, the
start site maps 5 bp downstream from the G at
97 (Fig. 2D, lanes 3 and 4). There is a slightly lower band also present in the S1 samples.
The 5-bp difference is not unusual since S1 nuclease often digests
slightly over the duplex DNA-RNA ends. Although the S1 band predicts a
+1 slightly lower than that for primer extension, the same promoter
10 and
35 elements identified for the upstream +1 may still apply
for a transcript starting 5 bp downstream. Combined, the results for
primer extension and S1 analysis clearly define P1 as the
iron-dependent cvaA promoter which is inducible only in the
log growth phases (Fig. 2).
Iron dependence of cvi transcription in a
cvi promoter fusion to lacZ.
To verify that the
potential promoter identified by primer extension corresponds to the
iron depletion-induced transcription of cvi, 90 bp of the
cvi promoter region from bp 4387 to 4286 (Fig. 3C) was
subcloned upstream of lacZ in a transcriptional fusion
vector, yielding ILZ-1.
-Galactosidase assays with MC4100/ILZ-1 grown with either iron or dipyridyl showed that transcription from the
cvi promoter is induced by iron depletion fourfold over repressed levels with iron (Fig. 4A).
However, the synthesis of Cvi induced with iron depletion compared to
basal levels with iron in the log phase is 8.5-fold, more than double
that observed for the Cvi transcriptional fusion, ILZ-1. This
difference may indicate translational control.
|
Iron-dependent transcriptional activity in lacZ fusion
with the entire cvaA promoter region.
For comparison
to primer extensions and immunoblots, samples of MC4100 cells
transformed with ALZ-1, containing the entire 320-bp cvaA
promoter region fused to lacZ, were grown under conditions identical to those used for primer extension and immunoblots and were
assayed for
-galactosidase activity. The ALZ-1 fusion was designed
as transcriptional, since the 3' fusion point was upstream of the ATG
translational start originally proposed for cvaA
(13). However, evidence recently showed that translation of
cvaA occurs from a TTG upstream of the originally proposed
ATG translational start (19). Although this fusion is out of
frame with translation, it could extend into coding regions of
cvaA. Therefore, we constructed a similar fusion (ALZ-1')
with the 3' end upstream of the TTG. The activities in the downstream
ATG fusion are not significantly different from activities observed for
the upstream TTG fusion when samples are grown under the same
conditions (data not shown).
-galactosidase in ALZ-1 is also consistent with primer
extensions since it is inducible by iron depletion in the logarithmic
but not the stationary growth phase.
Transcription from P1 in lacZ fusions is modulated by
downstream sequences.
Except as noted in Fig. 4B, only
transcriptional fusions upstream of TTG are included in the assays
described below. Also in Fig. 4B, higher levels of activity with both
iron and dipyridyl were achieved on samples grown in TB with no iron
until the time when iron or dipyridyl was added. Because some induction
occurs in TB with no iron or dipyridyl, this method gave higher and
slightly variable levels of activity. Therefore, it was important to
optimize conditions to achieve full repression so that induction
occurred from the same fully repressed point. Thus, all other
-galactosidase assays were performed only on log-phase cells grown
under conditions which achieved optimal repression, in TB with 0.05 mM
FeCl3 for the duration, followed by induction of an aliquot
of the repressed samples at mid-log phase with 0.1 mM 2,2'-dipyridyl.
184 upstream of P1 to bp
208 upstream of the TTG start codon was divided into four regions. The
P1 region includes the promoter predicted by primer extension and S1
analyses and 35 bp downstream of the transcriptional start. The P2, P3,
and P4 regions represent consecutive parts or regions of the sequences
downstream of the P1 promoter region and transcriptional start. Fusions
to lacZ which include these regions (designated P234) and
-galactosidase activities are depicted in Fig.
5. The fusion ALZ-1' upstream of the TTG
translational start possesses iron depletion-inducible activity. For
the reasons described above, the inducible level is up to about 220 Miller units lower. Induction for ALZ-1' is about fourfold higher than
levels with iron (Fig. 5A). Activity of a lacZ fusion with
the P2 region alone which includes sequences containing the promoter
and Fur binding site previously predicted (13, 14) was low
and not responsive to iron depletion (data not shown), which indicates
that this region does not code for an iron-responsive promoter as
predicted previously. A transcriptional fusion with the P1 promoter
alone was constructed for comparison to the fusion which includes
untranslated sequences downstream of the transcriptional start up to
the translational start. Dipyridyl-induced transcription from P1 alone
(ALZ-5) is inducible up to about 915 Miller units, which is
significantly higher than that seen from P1 with downstream sequences
present (ALZ-1') (Fig. 5A). The corresponding levels with iron are only slightly higher with P1 alone, about 87 Miller units (ALZ-5), compared
to about 56 Miller units for ALZ-1'. Accordingly, the relative levels
of induction are higher for P1 alone (ALZ-5), about 10-fold, compared
to the 4-fold induction for ALZ-1' (Fig. 5A). When the P2 region is
included downstream of P1 (a structure designate P1 P2, as in ALZ-7),
transcription levels are even higher than with P1 alone (ALZ-5) (Fig.
4A). Additionally, the relative induction with P2 included is about
fivefold (ALZ-7). This is due to increased transcription with iron
present in ALZ-7 (about 200 Miller units), which is more than twice the
level from P1 alone with iron (ALZ-5). Therefore, the relative levels
of induction for ALZ-7 (P1P2) and ALZ-1' (P1P234) are similar, about
four- to fivefold. However, the observed levels for ALZ-7 are close to
fourfold higher than those for ALZ-1' for both repressed and induced
conditions (Fig. 5A). Interestingly, when the P3 region is included
with P1 and P2 (ALZ-8), expression is almost fourfold less than for P1
P2 (ALZ-7) and similar to that for ALZ-1' (P1P234) (Fig. 5A). Including
P4 as in ALZ-1' reduces this activity slightly.
|
Secondary structure analysis. One possibility for the down-regulation resulting from the presence of sequences downstream of the P1 promoter is that it is due to secondary structures in the transcript. The primer extension bands could result from termination of reverse transcriptase as a result of secondary structures in the RNA transcripts. In fact, RNA secondary structures could be predicted within the cvaA RNA upstream of the artifactual primer extension bands mentioned above. One of these secondary structures occurs in the P3 region which was responsible for the down-regulation in transcriptional fusions and is designated the P3 stem-loop (Fig. 6A). Also possible is an extended secondary structure partly composed of the P3 stem-loop, encompassing the 3' end of the P2 and the entire P3 region; it is designated LP3 (Fig. 6B). Additional fusions were constructed to test the effects of the potential secondary structures.
|
Up-regulation of cvaA transcription in promoter fusions
with deletions in the downstream regions.
To ascertain the
importance of the apparent reduction in activity caused by the presence
of the P3 region, we constructed a series of deletions of the P3 region
as shown in Fig. 5B. In ALZ-14, the upper part of the P3 stem-loop was
deleted so that it was identical to ALZ-1' except for the deletion of
bp 45 to 100. Interestingly, this was not sufficient to cause
significant up-regulation of transcription from P1, and activities in
this fusion were only slightly higher than those observed for ALZ-1' (Fig. 5A, and B). Therefore, other parts of the P3 region may be
involved in down-regulation. A fusion with a deletion of all of the P3
stem-loop (ALZ-18) from bp 30 to 100 resulted in a 32 to 34% increase
in expression compared to ALZ-1' (Fig. 5B). This increased expression
is still not significant compared to the levels seen with ALZ-5 and
ALZ-7 without P3 (Fig. 5A). The extended stem-loop LP3 is followed by a
U-rich stretch (UUUUCCUU) (Fig. 6B) similar to that in some
transcriptional terminators (34). Even though the upper
portion of P3 was deleted in ALZ-14 and the entire upper stem-loop was
deleted in ALZ-18, a lower stem-loop with a free energy of
8.2
kcal/mol could still form in this construction (Fig. 6C). Therefore, we
constructed a fusion in which both the upper stem-loop and most of the
lower stem-loop were deleted (ALZ-21). This construction had a deletion
of bp 15 to 110 and significantly alleviated the down-regulation,
resulting in an approximate 2.5-fold increase in transcription (ALZ-21)
compared to ALZ-1' (Fig. 5A and B). Interestingly, with iron, the
transcriptional levels in ALZ-21 (122 Miller units) were higher than
those for ALZ-5 (P1 alone) (87 Miller units) but less than those for
ALZ-7 (P1P2) (203 Miller units) (Fig. 5A). This finding suggests that
with iron, the deletion in ALZ-21 may allow the enhancing potential of
the P2 region to be partially exhibited. However, the induced levels
for ALZ-21 were still less than those observed for ALZ-5 (P1 alone).
Transcriptional activity from P1 is modulated by mutations
downstream of the transcriptional start site.
The enhanced
transcriptional activity in the P2 region and down-regulation in the P3
region were possibly due to translation of two potential leader
peptides encoded downstream of the transcriptional start within the P2
region. The first potential leader, L1, is 10 amino acids, MNELCYFNIL,
and the second, L2, is 29 amino acids, MSYVTLIFSDNNLNQLDYCHLINNDILSS.
Mutation of the start codon of either leader from ATG to ACG does not
significantly change
-galactosidase activity (ALZ-19 and ALZ-20)
(Fig. 5C). Interestingly, mutation of both potential leader peptides
decreases the induced levels compared to ALZ-1' (Fig. 5C). It is not
certain that translational attenuation is involved in the
down-regulation. It is more likely that the reason for the
down-regulation by the double mutation in the P2 region is an
interference with the enhancing potential of this sequence. Thus, it is
possible that sequences downstream of the potential Fur box and
promoter influence transcription, transcription factors, or other
regulators.
Transcription of cvi is modulated by placing specific
cvaA sequences downstream of the cvi
promoter.
The modulating properties of the sequences downstream of
the cvaA transcriptional start were tested further on a
similarly regulated heterologous promoter. Thus, the
cvi-lacZ transcriptional fusion, ILZ-1, was used to evaluate
the effect of the cvaA downstream sequences on the
iron-regulated cvi promoter. The P2, P3, and P4 regions of
cvaA sequences between the cvaA promoter and gene were placed between the cvi promoter and lacZ
gene of ILZ-1. The cvi-cvaA hybrid plasmids constructed are
depicted in Fig. 5D.
-Galactosidase assays with the cvi
and cvi-cvaA hybrid transcriptional lacZ fusion
plasmids showed fourfold induction by iron depletion in the
cvi promoter fusion ILZ-1, similar to that observed for the
cvaA promoter fusion with downstream sequences, ALZ-1'
(3.9-fold) (Fig. 5A and D). The hybrid fusions revealed that including
the cvaA P2 region behind the cvi promoter
(ILZ-1-6) enhances transcription as it does for cvaA (ALZ-7)
(Fig. 5A and D). For ILZ-1-6, the increase with P2 is similar for
conditions with iron (40%) and dipyridyl (30%), whereas for ALZ-7 the
increase with P2 is much greater with iron, which concurrently
modulates the induction with dipyridyl from 10-fold (ALZ-5) to 5-fold
(ALZ-7) (Fig. 5A and D). Including both downstream P2P3 regions (bp
56 to 115) behind the cvi promoter (ILZ-1-13)
down-regulates transcription as it does following the cvaA
promoter (ALZ-8) compared to the promoters, ILZ-1 and ALZ-5,
respectively, alone (Fig. 5A and D). When all of the LP3 secondary
structure and a following U-rich sequence are included (P2P3 and the
following 19 bp of P4, bp
56 to 134) downstream of the cvi
promoter (ILZ-1-27), the decrease is even greater. Comparison of
cvi transcription in ILZ-1-27 to that ILZ-1-6 with P2 only
shows that the down-regulation by including bp 48 to 134 is 3.6-fold
for iron and 4.8-fold for dipyridyl (Fig. 5D). This is similar to
comparison of the analogous constructions in cvaA; P1 with
P234 (ALZ-1') compared to P1 with P2 only (ALZ-7) is also reduced
3.6-fold for iron and 4.8-fold for dipyridyl (Fig. 5A). When the entire
downstream cvaA region (P234) is placed behind cvi (ILZ-1-28), the activity is similar to that in ILZ-1-27
without the remaining 3' sequences from bp 135 to 208 (Fig. 5D).
56 to 115) contains much more of the LP3
secondary structure compared to the P3P3 region (bp 38 to 208) (Fig.
6B). Furthermore, including the remainder of the secondary structure
and the U-rich segment (ILZ-1-27) reduces the transcription even more.
This finding also implies that the secondary structure is responsible
for the down-modulation. A fusion with P4 only behind cvi
(ILZ-1-4) has no effect on the levels of transcription from the
cvi promoter (Fig. 5D). This fusion (ILZ-1-4) and the fusion
with P2 (ILZ-1-6) also show that the down-regulation by the P3 region
is not due to random insertion of intervening sequences since 102- to
104-bp sequences that do not include P3 do not down-regulate
transcription (Fig. 5D).
| |
DISCUSSION |
|---|
|
|
|---|
Historically, a virulence factor was considered a pathogenic trait only if it was directly involved in host injury. Therefore, the ColV trait was not considered pathogenic since the ColV genes are not directly required for pathogenicity (30). However, the definition of pathogenicity has been revised to include any trait which increases the proliferation or survival of a bacterium during the infection process (24). With this definition, the ColV trait could be considered a pathogenic trait since its presence aids in propagating the pathogenic ColV population by eliminating competing microorganisms (6). By maintaining the ColV population, it also facilitates proliferation of the pathogenic traits of the ColV plasmid. Furthermore, its importance to the infectious process is evident since it resides on the same plasmid and thus is closely linked to many other traits which do cause host injury. In this regard, it is significant that the ColV toxin was found to be regulated by iron and Fur, similar to many of the pathogenic genes to which it is closely linked. Earlier studies showed that the production of ColV is constitutively elevated in Fur mutants (6) and is induced in response to iron limitation (6, 14). However, these observations are solely based on the detection of ColV activity in the supernatant (6, 14). It has not been shown whether the ColV operons (Fig. 3A) are transcriptionally regulated by iron, and the operon promoters have not been identified. The cvaA gene is upstream of and overlapping cvaB and contained an identifiable consensus sequence for Fur-dependent regulation (FB-A2) (14). Therefore, a promoter upstream of the cvaA gene was presumably responsible for transcription of both genes. Though the previously identified Fur binding site for cvi was a close match to the consensus, that identified for cvaA was a weak match to the consensus (Fig. 3B). Therefore, there was some question as to whether cvaA was actually subject to Fur repression. This study set out to assess the iron dependence of Cvi and CvaA production and to characterize the predicted iron-responsive promoters of the cvaA and cvi genes of the ColV operons.
It was shown that production of both Cvi and CvaA is induced by iron
depletion (Fig. 1A). It was also found that the transcription of
cvaA is indeed iron regulated, but it begins from a promoter well upstream from that previously identified and lies very close to a
sequence (FB-A1) which is a close match to the consensus Fur binding
site (Fig. 3B). Results of three independent methods, primer extension,
S1 nuclease protection, and transcriptional
-galactosidase fusions,
used to identify the cvaA promoter support the conclusion
that transcription of cvaA occurs from one promoter, P1,
located 320 bp upstream of its translational start. In contrast to
cvaA, this study verified that the cvi promoter
resides exactly where it was predicted, about 50 bp upstream of the
cvi gene, within the previously identified Fur binding site
(FB-I) (14). Transcription from both the cvi and
cvaA promoters is highly induced in the logarithmic phase of
growth by iron depletion.
Transcriptional promoter fusions for cvaA revealed that
transcription from P1 alone is inducible 10-fold and considerably greater than transcription from P1 with downstream sequences present (ALZ-1' and ALZ-8) (Fig. 5A). It is interesting that including the
P2 region with P1 enhances the transcriptional activity as well as
modulating the relative induction to fivefold. This increase may be due
to inherent flexibility in the AT-rich P2 region. Maximal promoter
functioning is facilitated by contacts with DNA segments both upstream
and downstream of the
10 and
35 promoter elements (7).
In light of this finding, P2 flexibility immediately downstream of the
promoter may contribute to enhanced DNA contacts with RNA polymerase,
which could explain why transcription from the P1 promoter with the P2
region present is enhanced with both iron and dipyridyl. The potential
flexibility in the P2 region might also interfere with the binding of
Fur, accounting for the more than doubled transcription with iron when
P2 is included.
We also addressed the possibility that transcription of cvaA
is influenced by translation of potential leader peptides which might
alter the formation of the LP3 secondary structure. However, mutations
of the start codons of either leader did not result in any remarkable
change in
-galactosidase activities. Thus, it does not appear that
translation of a leader peptide occurs or contributes to regulation of
this system. Interestingly, a double mutation of both leader peptides
decreased the induction. It is interesting that the double mutation
changes two ATGs to ACGs. The effect of changing two bases from T to C
in the enhancer region may affect the flexibility of the DNA, resulting
in decreased transcription.
When included downstream of P1P2, the P3 region reduces transcription from P1 considerably. In reverse, the deletion or absence of sequences downstream of P1P2 results in fourfold-higher transcription from P1P2. This observation appears similar to those of early studies of the attenuation mechanisms for the histidine (his) and tryptophan (trp) operons, which showed increased expression of the structural genes with the deletion of a sequence similarly positioned between the promoter/operator and the structural genes (1, 20). As with the deletion of the P3 region, the deletion-dependent increases observed for his and trp are independent of their normal repressible nature; levels of both basal and derepressed transcription are increased. The deleted sequences for trp and his encode a rho-independent transcriptional terminator which controls the operon by attenuation. However, the up-regulation observed for the P3 deletion is much less than that observed for rho-independent terminators. The P3 region combined with upstream sequences forms a stable stem-loop structure, LP3. Although the AU-rich stem region of LP3 does not closely resemble a typical rho-independent terminator, which is much shorter and rich in CG base pairing, it is followed by a U-rich stretch, typical of most terminators (31). The deletion of a large portion of the LP3 sequence contributes to considerable derepression. Thus, this sequence is presumably responsible for the down-regulation.
This possibility was confirmed by testing the modulating properties of
the cvaA sequences on the cvi promoter. The
cvi-cvaA hybrid fusions confirm that the 114-bp P2
cvaA sequence (
56 to 48) enhances transcription from the
cvi promoter when it is placed downstream of it (Fig. 5D).
The hybrid fusions also confirm that the cvaA sequences P2P3
plus 19 bp in P4 (bp
56 to 134) contribute to maximal down-modulation
of transcription from cvi (ILZ-1-27). These sequences make
up the entire LP3 secondary structure and following poly(U) sequence
(Fig. 6B). Including the remaining secondary structure and the poly(U)
sequence behind the cvi promoter results in even lower
transcription than without the poly(U), an observation which supports a
termination-like mechanism (Fig. 5A). However, without the poly(U)
sequence, the cvaA sequences (
56 to 115) down-regulate
transcription considerably suggesting that the poly(U) enhances only
the down-regulation. Alternatively, the secondary structure may
interfere with translation. Increased secondary structure in the 5'
untranslated regions of eukaryotic mRNA has been shown to decrease the
efficiency of translation (23, 29). The same phenomena may
be responsible for the down-regulation in this case since including
potential secondary structure in the LP3 sequences contribute to
considerable down-regulation. Secondary structures in both the 5' and
3' untranslated regions of RNA are known to affect transcript stability
(3, 5, 22, 24).
In speculating on the physiological role of the down-regulation observed for the cvaA promoter, it is interesting to note the transcriptional activities of both the cvi and cvaA promoters in similar lacZ fusions. Fusions of the cvi promoter alone to lacZ are induced fourfold (up to 250 Miller units). Under the same conditions, these levels for cvi are similar to those for the cvaA promoter fusion with downstream sequences, which are induced fourfold (up to 220 Miller units). Without the downstream sequences, inducible transcription from the cvaA promoter is 916 Miller units, fourfold higher than for cvaA with downstream sequences or cvi alone. Therefore, the downstream sequences appear to regulate transcription of cvaA to levels similar to that of cvi. Evidence indicates that cvaB may be cotranscribed with cvaA, and cvaC also appears to be cotranscribed with cvi (unpublished observations). Therefore, the down-regulating properties of the cvaA downstream sequences appear to equalize transcription of the two operons. This feature may be important for optimal function of secretion. However, it is not certain whether differences in translational efficiency are present. It is also possible that transcriptional down-regulation of the cvaA-cvaB operon is a feature designed to protect the host cell. The protein sequence for CvaB predicts that it is an integral inner membrane protein with six membrane-spanning domains (14). Furthermore, evidence indicates that CvaB may be detrimental to the cell if overexpressed since attempts to overproduce it have failed (unpublished observations). This is not unusual for transmembrane secretory proteins. The SecY protein with 10 transmembrane domains is deleterious to E. coli cells when overproduced and/or unassociated with its complex partners (21). Thus, the down-regulating properties of the sequences downstream of the cvaA promoter may also be essential for cell survival by placing a limit on the amount of CvaB produced in addition to coordinating equivalent transcription of the genes involved in ColV production and secretion. Additionally, since there is the capacity for fourfold-elevated transcription from the cvaA promoter which is decreased under these conditions, there may be unknown conditions, such as severe stress, whereby transcription of the secretory genes must be significantly heightened, such that the need for rapid production outweighs preserving the safety of the cells from overproduction of the secretion genes. In this case, some unknown factor(s) may interfere with the down-regulation by the downstream sequences.
In all, this study identifies the two iron-regulated promoters of the ColV operons and reveals a unusual mechanism of regulation for fine-tuning transcription of a gene involved in secretion of the bacterial toxin ColV. The observation that transcription from the promoter alone is significantly higher than with the modulating downstream sequences suggests that there may be unknown mechanisms whereby the down-regulation is averted. The exact nature of the down-modulation is under investigation.
| |
ACKNOWLEDGMENTS |
|---|
We thank Roberto Kolter for graciously providing plasmid pHK11 and strains used in this study. We also thank Jai Hwang for providing purified CvaA antibody, John Houghton for numerous discussions, and Tim Brown for the primer extension protocol. Thanks also go to Ken Chen for assistance in times of need.
This work was supported in part by an NIH grant and by equipment grants from Georgia Research Alliance.
| |
FOOTNOTES |
|---|
* Corresponding author. Mailing address: 24 Peachtree Center Ave., 402 Kell Hall, Department of Biology, Georgia State University, Atlanta, GA 30303. Phone: (404) 651-3109. Fax: (404) 651-2509. E-mail: biopct{at}panther.gsu.edu.
| |
REFERENCES |
|---|
|
|
|---|
| 1. | Bertrand, K., C. Squires, and C. Yanofsky. 1976. Transcription termination in vivo in the leader region of the tryptophan operon of Escherichia coli. J. Mol. Biol. 102:319-337. |
| 2. | Binns, M. M., D. C. Davies, and K. G. Hardy. 1979. Cloned fragments of the plasmid ColV, I-K94 specifying virulence and serum resistance. Nature 279:778-781[Medline]. |
| 3. | Bouvet, P., and J. G. Belasco. 1992. Control of RNaseE-mediated RNA degradation by 5'-terminal base pairing in E. coli. Nature 360:488-491[Medline]. |
| 4. |
Calderwood, S. B., and J. J. Mekalanos.
1987.
Iron regulation of shiga-like toxin expression in Escherichia coli is mediated by the fur locus.
J. Bacteriol.
169:4759-4764 |
| 5. | Casey, J. L., D. M. Koeller, V. C. Ramin, R. D. Klausner, and J. B. Harford. 1989. Iron regulation of transferrin receptor mRNA levels requires iron-responsive elements and a rapid turnover determinant in the 3' untranslated region of the mRNA. EMBO J. 8:3693-3699[Medline]. |
| 6. | Chehade, H., and V. Braun. 1988. Iron-regulated synthesis and uptake of colicin V. FEMS Microbiol. Lett. 52:177-182. |
| 7. | Choy, H., and S. Adhya. 1996. Negative control, p. 1287-1299. In F. C. Neidhardt, R. Curtiss III, J. L. Ingraham, E. C. C. Lin, K. B. Low, B. Magasanik, W. S. Reznikoff, M. Riley, M. Schaechter, and H. E. Umbarger (ed.), Escherichia coli and Salmonella: cellular and molecular biology, 2nd ed. ASM Press, Washington, D.C. |
| 8. |
Clancy, J., and D. C. Savage.
1981.
Another colicin V phenotype: in vitro adhesion of Escherichia coli to mouse intestinal epithelium.
Infect. Immun.
32:343-352 |
| 9. |
deLorenzo, V.,
S. Wee,
M. Herrero, and J. B. Neilands.
1987.
Operator sequences of the aerobactin operon of plasmid ColV-K30 binding the ferric uptake regulation (Fur) repressor.
J. Bacteriol.
169:2624-2630 |
| 10. |
Dinh, T.,
I. T. Paulsen, and M. H. Saier, Jr.
1994.
A family of extracytoplasmic proteins that allow transport of large molecules across the outer membranes of Gram-negative bacteria.
J. Bacteriol.
176:3825-3831 |
| 11. |
Farinha, M. A., and A. M. Kropinski.
1990.
Construction of broad-host-range plasmid vectors for easy visible selection and analysis of promoters.
J. Bacteriol.
172:3496-3499 |
| 12. |
Gilson, L.,
H. K. Mahanty, and R. Kolter.
1987.
Four plasmid genes are required for colicin V synthesis, export, and immunity.
J. Bacteriol.
169:2466-2470 |
| 13. | Gilson, L., H. K. Mahanty, and R. Kolter. 1990. Genetic analysis of an MDR-like export system: the secretion of colicin V. EMBO J. 9:3875-3884[Medline]. |
| 14. | Gilson, L. 1990. . Genetic analysis of a signal sequence-independent protein transport system: secretion of colicin V. Ph.D. dissertation. Harvard University, Cambridge, Mass. |
| 15. |
Hardy, K. G.
1975.
Colcinogeny and related phenomena.
Bacteriol. Rev.
39:464-515 |
| 16. | Harlow, E., and D. Lane. 1988. . Antibodies: a laboratory manual. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. |
| 17. |
Herschman, H. R., and D. R. Helinski.
1967.
Comparative study of the events associated with colicin induction.
J. Bacteriol.
94:691-699 |
| 18. |
Houghton, J. E.,
T. M. Brown,
A. J. Appel,
E. J. Hughes, and L. N. Ornston.
1995.
Discontinuities in the evolution of Pseudomonas putida cat genes.
J. Bacteriol.
177:401-412 |
| 19. |
Hwang, J.,
M. Manuvakhova, and P. C. Tai.
1997.
Characterization of in-frame proteins encoded by cvaA, an essential gene in the colicin V secretion system: CvaA* stabilizes CvaA to enhance secretion.
J. Bacteriol.
179:689-696 |
| 20. | Jackson, E. N., and C. Yanofsky. 1973. The region between the operator and first structural gene of the tryptophan operon of Escherichia coli may have a regulatory function. J. Mol. Biol. 76:89-101[Medline]. |
| 21. |
Kihara, A.,
Y. Akiyama, and K. Ito.
1991.
FtsH is required for proteolytic elimination of uncomplexed forms of SecY, an essential protein translocase subunit.
Proc. Natl. Acad. Sci. USA
92:4532-4536 |
| 22. | Klausner, R. D., T. A. Rouault, and J. B. Harford. 1993. Regulating the fate of mRNA: the control of cellular iron metabolism. Cell 72:19-28[Medline]. |
| 23. |
Kozak, M.
1986.
Influences of mRNA secondary structure on initiation by eukaryotic ribosomes.
Proc. Natl. Acad. Sci. USA
83:2850-2854 |
| 24. | Kulkarnl, R. D., and S. S. Gordon. 1997. mRNA stability is regulated by a coding-region element and the unique 5' untranslated leader sequences of the three Synechococcus psbA transcripts. Mol. Microbiol. 24:1131-1142[Medline]. |
| 25. | Mahan, M. J., J. M. Slauch, and J. J. Mekalanos. 1996. Environmental regulation of virulence gene expression in Escherichia, Salmonella, and Shigella spp., p. 2803-2815. In F. C. Neidhardt, R. Curtiss III, J. L. Ingraham, E. C. C. Lin, K. B. Low, B. Magasanik, W. S. Reznikoff, M. Riley, M. Schaechter, and H. E. Umbarger (ed.), Escherichia coli and Salmonella: cellular and molecular biology, 2nd ed. ASM Press, Washington, D.C. |
| 26. | Miller, J. H. 1972. . Experiments in molecular genetics. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. |
| 27. | Mullis, K. B., and F. A. Faloona. 1987. Specific synthesis of DNA in vitro via a polymerase-catalyzed chain reaction. Methods Enzymol. 155:335-350[Medline]. |
| 28. | Pelletier, J., and N. Sonenberg. 1985. Insertion mutagenesis to increase secondary structure within the 5' noncoding region of a eukaryotic mRNA reduces translational efficiency. Cell 40:515-526[Medline]. |
| 29. |
Quackenbush, R. L., and S. Falkow.
1979.
Relationship between colicin V activity and virulence in Escherichia coli.
Infect. Immun.
24:562-564 |
| 30. | Reynolds, R., R. M. Bermudez-Cruz, and M. J. Chamberlin. 1992. Parameters affecting transcription termination by Escherichia coli RNA polymerase. Analysis of 13 rho-independent terminators. J. Mol. Biol. 224:31-51[Medline]. |
| 31. | Sambrook, J., E. F. Fritsch, and T. Maniatis. 1989. . Molecular cloning: a laboratory manual, 2nd ed. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. |
| 32. | Smith, H. W. 1974. A search for transmissible pathogenic characters in invasive strains of Escherichia coli: the discovery of a plasmid-controlled toxin and plasmid-controlled lethal character closely associated or identical with colicin V. J. Gen. Microbiol. 83:95-111[Medline]. |
| 33. | Smith, H. W., and M. B. Higgins. 1976. Further observations of the association of the colicin V plasmid of Escherichia coli with pathogenicity and with survival in the alimentary tract. J. Gen. Bacteriol. 92:335-350. |
| 34. |
Williams, P. H.
1979.
Novel iron uptake system specified by ColV plasmids: an important component in the virulence of invasive strains of Escherichia coli.
Infect. Immun.
26:925-932 |
This article has been cited by other articles: