Previous Article | Next Article ![]()
Journal of Bacteriology, October 1999, p. 6306-6311, Vol. 181, No. 20
Laboratoire d'Ingéniérie des
Systèmes Macromoléculaires, Institut de Biologie
Structurale et Microbiologie, Centre National de la Recherche
Scientifique (CNRS), 13402 Marseille Cedex 20, France
Received 6 May 1999/Accepted 26 July 1999
The Tol-peptidoglycan-associated lipoprotein (PAL) system of
Escherichia coli is a multiprotein complex of the envelope
involved in maintaining outer membrane integrity. PAL and the
periplasmic protein TolB, two components of this complex, are
interacting with each other, and they have also been reported to
interact with OmpA and the major lipoprotein, two proteins interacting with the peptidoglycan. All these interactions suggest a role of the
Tol-PAL system in anchoring the outer membrane to the peptidoglycan. Therefore, we were interested in better understanding the interaction between PAL and the peptidoglycan. We designed an in vitro interaction assay based on the property of purified peptidoglycan to be pelleted by
ultracentrifugation. Using this assay, we showed that a purified PAL
protein interacted in vitro with pure peptidoglycan. A peptide competition experiment further demonstrated that the region from residues 89 to 130 of PAL was sufficient to bind the peptidoglycan. Moreover, the fact that this same region of PAL was also binding to
TolB suggested that these two interactions were exclusive. Indeed, the
TolB-PAL complex appeared not to be associated with the peptidoglycan.
This led us to the conclusion that PAL may exist in two forms in the
cell envelope, one bound to TolB and the other bound to the peptidoglycan.
The cell envelope of gram-negative
bacteria consists of three layers, the inner membrane, the outer
membrane, and the rigid peptidoglycan layer that lies between them in
the periplasmic space. Although the components of this envelope have
been extensively studied and the three-dimensional structures of some
of the proteins have been determined, we still have a limited
understanding of their interactions and their assembly mechanism. There
is evidence that the peptidoglycan interacts with numerous cell
envelope proteins and that these interactions play an important role in
the cell envelope organization.
One of the proteins for which such an interaction has been shown is the
peptidoglycan-associated lipoprotein (PAL) (28, 29). PAL
belongs to the Tol-PAL system, whose proteins are encoded by two
operons located at 17 min on the chromosomal map of Escherichia coli (23, 36). The Tol-PAL system consists of several
proteins that form two complexes. One, located in the cytoplasmic
membrane, consists of the TolA, TolQ, and TolR proteins, which interact with each other by their transmembrane segments (10, 14, 18, 24). The other is linked to the outer membrane and is composed of
PAL and the periplasmic protein TolB (4, 17).
The tol-pal genes are involved in maintaining outer membrane
integrity (22, 23). Mutations in these genes result in the formation of outer membrane vesicles (3), thus indicating a defect in cell envelope assembly similar to that observed in
lpp or ompA mutants (13, 34).
Furthermore, Tol proteins have been parasitized to permit group A
colicins and single-stranded phage DNA to be transported through the
outer membrane (for a review, see reference 21). The
Tol-PAL system must play an important role in the envelopes of
gram-negative bacteria, since it has been described for
Haemophilus influenzae, Pseudomonas aeruginosa, Pseudomonas putida, Actinobacillus
pleuropneumoniae, and Helicobacter pylori with similar
organizations (9, 12, 32, 33) (GenBank accession no.
AE000619). Moreover, homologues of PAL have been found in an even
larger number of gram-negative bacteria.
Recently, it has been shown that TolB interacts with Lpp and OmpA and
that PAL also interacts with OmpA (7). Furthermore, TolB
interacts with trimeric porins of the outer membrane, as does TolA
(11, 31). Thus, it appears that the TolB and PAL proteins
may be parts of a larger complex involved in anchoring the outer
membrane to the peptidoglycan. In this regard, the interaction of PAL
with the peptidoglycan should be crucial for the function of the
Tol-PAL system.
The interaction of PAL with the peptidoglycan has been characterized by
the solubility properties of PAL. In 2% sodium dodecyl sulfate (SDS),
PAL is solubilized from an envelope preparation only when heated above
50°C. At 40°C, PAL is not solubilized even when 0.6 M NaCl is added
(28, 29). In practice, the interaction of PAL with the
peptidoglycan is tested in vivo by incubating whole cell envelopes in
Laemmli buffer at 37°C. Under these conditions, PAL is not
solubilized. Furthermore, several lipoproteins which are cross-linked
to the peptidoglycan by dithiobis(succinimidylpropionate) have been
detected, and it was proposed that one of them was PAL (26).
Using PAL-PhoA fusion protein constructs, Lazzaroni and Portalier
(23) found that a region located between residues 101 and
116 of PAL was involved in the interaction with the peptidoglycan. In
E. coli, this region is localized in a domain also found in OmpA and MotB, two proteins thought to be associated with the peptidoglycan, and in YfiB and YiaD, two lipoproteins with no known
function (8). Moreover, a highly conserved sequence (from residues 97 to 114 in PAL) has a strong probability of adopting an
In this study, experiments were carried out to further investigate the
interactions between PAL, TolB, and the peptidoglycan and to localize
the regions of PAL involved. It is not easy to precisely localize the
region of interaction of PAL with the peptidoglycan in vivo because of
the different levels of expression of PAL when mutations are
introduced. Furthermore, mutations in PAL could also affect the
properties of the cell envelope, which would then affect the solubility
of the PAL protein. To circumvent this problem, we developed a new in
vitro system to assay the interaction between purified PAL protein and
purified peptidoglycan. In addition, we used a synthetic peptide
covering the region of PAL thought to bind to the peptidoglycan to
perform competition analyses. We demonstrated that this region alone is
able to interact with the peptidoglycan. Furthermore, this same peptide
was able to interact with TolB. This led us to the conclusion that PAL
interacts either with TolB or with the peptidoglycan but cannot bind to the two molecules at the same time.
Purification of PAL, TolB, TolR, and the peptidoglycan.
PAL
was purified by exactly the same protocol described for the
purification of PAL from H. influenzae (37). We
used 1 liter of an E. coli C600 culture at an optical
density at 600 nm (OD600) of 1. At the end of the
procedure, the buffer was exchanged for 50 mM sodium phosphate buffer
(pH 8)-0.08% Triton X-100 by using a PD-10 column (Pharmacia), and
the PAL protein was recovered in a 1-ml fraction. The homogeneity of
the PAL protein obtained was checked by SDS-polyacrylamide gel
electrophoresis (PAGE).
0021-9193/99/$04.00+0
Copyright © 1999, American Society for Microbiology. All rights reserved.
In Vitro Characterization of
Peptidoglycan-Associated Lipoprotein (PAL)-Peptidoglycan and
PAL-TolB Interactions

![]()
ABSTRACT
Top
Abstract
Introduction
Materials and Methods
Results
Discussion
References
![]()
INTRODUCTION
Top
Abstract
Introduction
Materials and Methods
Results
Discussion
References
-helical conformation, with the more conserved residues located at
one face. It has been proposed that this 18-residue sequence associates
with the peptidoglycan (19).
![]()
MATERIALS AND METHODS
Top
Abstract
Introduction
Materials and Methods
Results
Discussion
References
Electrophoresis, immunoblotting, and antibodies. SDS-PAGE and electrotransfer onto nitrocellulose were performed as described previously (20, 35). After transfer, the nitrocellulose membrane was treated with the antisera directed against TolB, PAL, and TolR, as previously described (4, 15, 18, 31).
Peptide synthesis. The TolR peptide, consisting of residues 113 to 141 of the TolR protein with an additional cysteine at the N terminus (CKDVPYDEIIKALNLLHSAGVKSVGLMTQP), and the PAL peptide, consisting of residues 89 to 130 of the mature PAL protein (DERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYGKE), were synthesized according to the method of Barany and Merrifield (1). We used a resin preloaded with 4-hydroxymethyl-phenoxy-methyl-copolystyrene-1% divinylbenzene (0.5 to 0.65 mmol) (Perkin-Elmer, Applied Biosystems Inc.) and an automated synthesizer (model 433A; Perkin-Elmer, Applied Biosystems Inc.). Purification was done with a Beckman high-pressure liquid chromatography apparatus on a Merck C8 reverse-phase column. After lyophilization, the peptides were resuspended in 10 mM sodium phosphate buffer, pH 8. Electrospray mass spectrometry, carried out with a single quad PE-SCIEX API 150ex spectrometer (Perkin-Elmer), and amino acid analyses, performed on a model 6300 Beckman analyzer, showed that synthesis of these two peptides was successful.
In vitro assay for PAL-peptidoglycan binding. Five micrograms of the purified PAL protein (or TolRIIHis protein), which was first centrifuged for 30 min at 400,000 × g, and 50 µl of purified peptidoglycan were incubated in 10 mM sodium phosphate buffer-150 mM NaCl, pH 8, for 1 h at room temperature (final volume, 100 µl). The mixture was then centrifuged for 30 min at 400,000 × g (Beckman TL100). The supernatant was collected, and the pellet was washed in 500 µl of 10 mM sodium phosphate buffer-500 mM NaCl, pH 8. After identical centrifugation, the wash fraction was collected. Finally, the pellet was resuspended in 40 µl of Laemmli buffer and heated for 10 min at 96°C. After precipitation of the supernatant and wash fractions with 20% trichloroacetic acid, the supernatant, wash, and pellet fractions were analyzed by Western blotting with an anti-PAL antibody.
To carry out the competition experiments between PAL and the PAL peptide, two amounts (20 and 100 µg) of the PAL peptide or 250 µg of the TolR peptide, which were first centrifuged at 400,000 × g, were incubated for 1 h with 50 µl of purified peptidoglycan. PAL protein was then added, and the rest of the experiment was performed as described above.In vivo and in vitro cross-linking with formaldehyde. In vivo cross-linking experiments with formaldehyde were performed directly on whole cells overexpressing TolB and PAL proteins (strain JC7752 transformed with pBP [4]) for 20 min as described previously (4) and stopped with 10 mM Tris, pH 6.8. Cell envelopes were prepared and treated in 2% SDS-0.1 M NaCl-10% glycerol-10 mM Tris (pH 7.8) at 37°C for 10 min to recover the non-peptidoglycan-associated fraction. Then the pellet was treated in Laemmli loading buffer at 60°C for 10 min to solubilize the peptidoglycan-associated proteins.
For the in vitro experiments, purified TolB (5 µg) and purified PAL (5 µg), in 10 mM sodium phosphate buffer, were mixed in a 15-µl final volume and incubated for 1 h at room temperature. Formaldehyde (1% final concentration) was added, and the mixture was further incubated for 20 min. Cross-linking was stopped by the addition of 10 mM Tris, pH 6.8. The samples were heated at 37°C for 10 min in Laemmli loading buffer and analyzed by SDS-PAGE and Western blotting.| |
RESULTS |
|---|
|
|
|---|
Purified PAL interacts with peptidoglycan in vitro. To set up a new system allowing detection of the interaction between PAL and the peptidoglycan in vitro, these two molecules were first purified.
The PAL lipoprotein of E. coli was purified by the protocol described by Zlotnick et al. (37). This method, originally used for the purification of the PAL homologue in H. influenzae, consists of several membrane extraction steps with detergents. We followed this method without modification for E. coli C600. After purification, a Coomassie blue-stained gel revealed the presence of three minor contaminants of 7, 32, and 67 kDa (data not shown). The first two may correspond to Lpp and porins, respectively. However, the PAL lipoprotein was more than 95% pure. We obtained approximately 0.5 mg of PAL for 1 liter of culture. Peptidoglycan was prepared by the protocol described by Leduc et al. (25) (see Materials and Methods). For our assays, we used the property of this purified peptidoglycan to be pelleted by ultracentrifugation at 400,000 × g for 30 min. Therefore, proteins added to the preparation and able to interact with the peptidoglycan should also be pelleted upon ultracentrifugation. When PAL was incubated with peptidoglycan, the PAL protein pelleted with the peptidoglycan after ultracentrifugation, even after being washed with 0.5 M NaCl (Fig. 1). A negative-control experiment was performed with the purified periplasmic domain of the TolR protein, corresponding to residues 44 to 117 (18). It appeared that this domain of TolR did not pellet with the peptidoglycan after ultracentrifugation (Fig. 1).
|
The PAL-peptidoglycan interaction is displaced by a peptide composed of residues 89 to 130 of PAL. The in vitro binding assay described above may be used to determine the regions of a protein involved in this binding. Indeed, peptides binding with the peptidoglycan should compete with the entire protein. We chose to test this hypothesis with a PAL peptide corresponding to residues 89 to 130. This peptide encompasses the region thought to be responsible for the interaction with the peptidoglycan (8, 19, 23) and also several residues which were shown to be involved in TolB and peptidoglycan interaction in vivo (7). Another peptide, corresponding to the C-terminal domain of the TolR protein (from residues 113 to 141), was used as a control.
The PAL peptide was added to the PAL-peptidoglycan interaction assay described above at two different concentrations. The peptide prevented the pelleting of the PAL protein with the peptidoglycan in a dose-dependent manner (Fig. 2A). An effect was detected with as little as 20 µg of PAL peptide, representing a 20-fold molar excess compared to the PAL full-length protein (50 µM peptide and 2.5 µM full-length PAL [5 µg]). A control experiment was performed with the peptide corresponding to residues 113 to 141 of the TolR protein. This control peptide did not prevent the pelleting of PAL with the peptidoglycan, even at a concentration higher than the maximum used with the PAL peptide (Fig. 2B). Therefore, the PAL peptide specifically prevented the PAL-peptidoglycan interaction, which suggests that this peptide interacted with the peptidoglycan. The peptide, or part of it, would then adopt a conformation which must be close to the native conformation of this stretch of residues in the entire protein.
|
The PAL-TolB interaction is displaced by the peptide composed of residues 89 to 130 of PAL. The TolB-PAL interaction has been well characterized in vivo (4, 7). Using purified TolB and PAL proteins, we tested whether this interaction could also be detected in vitro by using cross-linking with formaldehyde. When these two purified proteins were mixed in the presence of 1% formaldehyde and analyzed by Western blotting, a complex of 65 kDa was detected with antibodies directed against TolB and PAL (Fig. 3A). This complex corresponded to the size of the complex obtained in vivo on whole cells. This constitutes the third way to detect the interaction between TolB and PAL, in addition to formaldehyde cross-linking in vivo and coimmunoprecipitation of PAL with TolB (4).
|
The TolB-PAL complex does not interact in vivo with the peptidoglycan. Our results indicated that the region of PAL spanning residues 89 to 130 interacted with TolB and the peptidoglycan. We wanted to know if these two interactions could take place together or if they were exclusive.
In our previous work, the TolB-PAL complex detected in vivo after cross-linking with formaldehyde was solubilized at 37°C (4). Yet the PAL protein was described as peptidoglycan associated, since it was solubilized in the Laemmli buffer only when heated to at least 50°C (23, 29). Therefore, to better define the solubilization properties of the cross-linked TolB-PAL complex, we performed in vivo cross-linking experiments. After cross-linking whole cells with formaldehyde, envelopes were prepared. The samples were first heated to 37°C and then to 60°C (Fig. 4). The PAL lipoprotein was detected mainly in the 60°C samples, whereas the TolB-PAL complex was detected only in the 37°C sample. We verified that the TolB-PAL complex was not destroyed by treatment at 60°C by incubating the membranes directly at 60°C. Therefore, the TolB-PAL complex is not peptidoglycan associated, suggesting that PAL cannot bind to TolB and to the peptidoglycan at the same time. This is in agreement with the idea that it is the same region, contained in the synthetic peptide, which is responsible for both the interaction with TolB and that with the peptidoglycan.
|
| |
DISCUSSION |
|---|
|
|
|---|
In this study, we describe a new assay that allowed us to study the binding of PAL to the peptidoglycan in vitro.
We showed that the peptide composed of residues 89 to 130 of PAL competed with a full-length PAL for interaction with the peptidoglycan. To obtain a competition effect, we had to add approximately 20 times as much of the peptide as of the full-length protein. However, we do not know the nature of the sites of interaction in the peptidoglycan, and therefore we do not know the number of these sites. However, since all of the PAL protein binds to the peptidoglycan, it is highly probable that the number of sites in the peptidoglycan is not a limiting factor. Therefore, a 20-fold excess of peptide to obtain a competition suggests that the peptide interaction is efficient and that the peptide is correctly folded. Previous studies have identified mutations that impaired the interaction of PAL with the peptidoglycan (7). Most of them are in the region from residues 89 to 130, but residue substitutions outside this region (positions Gly86, Ala88, and Arg146) were also shown to affect peptidoglycan binding in vivo (7). This suggests that these residues, even if not directly participating in the peptidoglycan interaction, can affect it by changing the conformation of PAL.
The use of purified TolB and PAL proteins provided us a new way of detecting the interaction between these two proteins. Here again, the PAL peptide corresponding to residues 89 to 130 was able to interact with TolB, therefore competing with the full-length lipoprotein for binding to TolB. To obtain a competition effect, we had to add approximately 40 times as much of the peptide as of the full-length protein. Since only a small fraction of TolB and PAL proteins are cross-linked (in vitro as well as in vivo), it is not easy to come to a conclusion regarding these relative amounts. However, we can conclude that at least a fraction of the peptide interacted with TolB. One could wonder why the TolB-peptide complex was not detected by anti-TolB antibodies (cf. Fig. 3B). First, the difference in size between TolB and the complex might be too small to be detected. Second, it is possible that the peptide interacts with TolB without being able to be cross-linked by the formaldehyde but is still sufficient to prevent the full-length PAL protein from binding.
Therefore, we concluded that the PAL peptide comprising residues 89 to 130 was able to interact with TolB and with the peptidoglycan. This, added to the fact that PAL does not bind to TolB and to the peptidoglycan at the same time in vivo, suggests that it is exactly the same region which binds to these two partners.
The two forms of PAL (bound to TolB or bound to the peptidoglycan), as well as the two forms of TolB (free and bound to PAL), must have a physiological significance.
One may speculate, for example, that these different associations play a role in the crossing of the murein sacculus by the colicins. PAL proteins bound to TolB, and not to the peptidoglycan, may define special points in the envelope where the crossing of the peptidoglycan is possible. The colicin could then reach the inner membrane TolA protein, with which they have been shown to interact (2, 6). This hypothesis is consistent with the fact that the TolB-PAL system may constitute contact sites between the inner and outer membranes, allowing the translocation of colicins (16). Although tol mutants are tolerant of colicin action, a pal null mutant is still sensitive to these toxins. However, several studies have demonstrated an indirect involvement of PAL in the translocation of colicins. First, it has been shown that the binding of colicin E3 to TolB prevents the interaction of TolB with PAL (5). Second, point mutations in PAL have been obtained which rendered cells tolerant to colicins (7), perhaps by affecting the step in which TolB is released from the TolB-PAL interaction, when the colicin interacts with TolB.
From another point of view, the shuttling of a protein from a periplasmic and soluble state to a lipoprotein binding state is reminiscent of the shuttling of LolA from a soluble and periplasmic state to a lipoprotein LolB binding state during the transport of lipoproteins to the outer membrane (27). It is therefore very tempting to postulate a role for the Tol-PAL system in transport, including a function of crossing the peptidoglycan where TolB would be the carrier, shuttling between PAL in the outer membrane and the TolQRA proteins in the inner membrane.
Finally, it is still possible that the PAL and TolB proteins also play
a role independent of the whole Tol system. Indeed, the C-terminal
domain of PAL is present in three other proteins in E. coli,
the most important being OmpA (19). It is striking that the
periplasmic domain of OmpA is so homologous to that of PAL. It seems
that the same protein domain can be anchored to the outer membrane
either by a lipid tail or by a protein domain, as is the case for OmpA,
whose membrane anchor structure has been determined and shown to be a
-barrel of eight strands (30). One can speculate that the
associations of PAL and OmpA with the peptidoglycan are to a certain
extent redundant. Furthermore, the finding that TolB, PAL, Lpp, and
OmpA may be parts of the same complex points to a role for these
proteins in the association of the outer membrane with the underlying
peptidoglycan (7).
The new assay system presented in this paper, relying on direct protein-protein or protein-peptidoglycan interactions, will be useful for investigating protein domains and their interactions in more detail. The use of smaller peptides will permit precise determination of the minimal region involved in protein-peptidoglycan binding. In addition, the assay can be used to test the effect of mutations in PAL on its binding behavior. This implies the prior purification of the mutated proteins. However, it seems the most interesting development of our in vitro system, since the study of mutations in PAL in vivo appears to be difficult. Finally, this new assay might also be useful in characterizing the interactions of other membrane components, like OmpA and MotB, with the peptidoglycan.
| |
ACKNOWLEDGMENTS |
|---|
We thank Jacques Bonicel, who performed the mass spectrometry analyses. We are grateful to Laure Journet for the gift of purified TolRIIHis. We thank Harold Cremer and Pascal Lopez for carefully reading the manuscript.
E. Bouveret was a recipient of an AMN fellowship. This work was supported by the Life Science department and the Mission Physique et Chimie du Vivant of the CNRS, by the INSERM Programme Environnement Santé 96 (EN96C3), and the European Community (BIO4-CT97-2313).
| |
FOOTNOTES |
|---|
* Corresponding author. Present address: EMBL Meyerhofstrasse-1, D-69117 Heidelberg, Germany. Phone: (49) (0) 6221 387492. Fax: (49) (0) 6221 387518. E-mail: bouveret{at}embl-heidelberg.de.
Present address: Centre de Biophysique Moléculaire, 45071 Orleans Cedex 2, France.
| |
REFERENCES |
|---|
|
|
|---|
| 1. | Barany, G., and R. B. Merrifield. 1980. In E. Gross, and J. Meinhofer (ed.), The peptide: analysis, synthesis, biology, vol. 2. , p. 1-284. Academic Press, New York, N.Y. |
| 2. | Bénédetti, H., C. Lazdunski, and R. Lloubès. 1991. Protein import into Escherichia coli: colicins A and E1 interact with a component of their translocation system. EMBO J. 10:1989-1995[Medline]. |
| 3. |
Bernadac, A.,
M. Gavioli,
J. C. Lazzaroni,
S. Raina, and R. Lloubès.
1998.
Escherichia coli mutants form outer membrane vesicles.
J. Bacteriol.
180:4872-4878 |
| 4. |
Bouveret, E.,
R. Dérouiche,
A. Rigal,
R. Lloubès,
C. Lazdunski, and H. Bénédetti.
1995.
Peptidoglycan-associated lipoprotein-TolB interaction.
J. Biol. Chem.
270:11071-11077 |
| 5. | Bouveret, E., A. Rigal, C. Lazdunski, and H. Bénédetti. 1997. The N-terminal domain of colicin E3 interacts with TolB which is involved in the colicin translocation step. Mol. Microbiol. 23:909-920[Medline]. |
| 6. | Bouveret, E., A. Rigal, C. Lazdunski, and H. Bénédetti. 1998. Distinct regions of the colicin A translocation domain are involved in the interaction with TolA and TolB proteins upon import into Escherichia coli. Mol. Microbiol. 27:143-157[Medline]. |
| 7. | Clavel, T., P. Germon, A. Vianney, R. Portalier, and J. C. Lazzaroni. 1998. TolB protein of Escherichia coli K-12 interacts with the outer membrane peptidoglycan-associated proteins Pal, Lpp and OmpA. Mol. Microbiol. 29:359-367[Medline]. |
| 8. | De Mot, R., and J. Vanderleyden. 1994. The C-terminal sequence conservation between OmpA-related outer membrane proteins and MotB suggests a common function in Gram-positive and Gram-negative bacteria, possibly in the interaction of these domains with peptidoglycan. Mol. Microbiol. 12:333-334[Medline]. |
| 9. |
Dennis, J. J.,
E. R. Lafontaine, and P. A. Sokol.
1996.
Identification and characterization of the tolQRA genes of Pseudomonas aeruginosa.
J. Bacteriol.
178:7059-7068 |
| 10. |
Dérouiche, R.,
H. Bénédetti,
J. C. Lazzaroni,
C. Lazdunski, and R. Lloubès.
1995.
Protein complex within Escherichia coli inner membrane: TolA N-terminal domain interacts with TolQ and TolR proteins.
J. Biol. Chem.
270:11078-11084 |
| 11. | Dérouiche, R., M. Gavioli, H. Bénédetti, A. Prilipov, C. Lazdunski, and R. Lloubès. 1996. TolA central domain interacts with Escherichia coli porins. EMBO J. 15:6408-6415[Medline]. |
| 12. | Frey, J., P. Kuhnert, L. Villiger, and J. Nicolet. 1996. Cloning and characterization of an Actinobacillus pleuropneumoniae outer membrane protein belonging to the family of PAL lipoproteins. Res. Microbiol. 147:351-361[Medline]. |
| 13. |
Fung, J.,
T. J. MacAlister, and L. I. Rothfield.
1978.
Role of murein lipoprotein in morphogenesis of the bacterial division septum: phenotypic similarity of lkyD and lpo mutants.
J. Bacteriol.
133:1467-1471 |
| 14. |
Germon, P.,
T. Clavel,
A. Vianney,
R. Portalier, and J. C. Lazzaroni.
1998.
Mutational analysis of the Escherichia coli K-12 TolA N-terminal region and characterization of its TolQ-interacting domain by genetic suppression.
J. Bacteriol.
180:6433-6439 |
| 15. | Gorvel, J.-P., A. Rigal, J. Sarles, and S. Maroux. 1985. Aminopeptidase N and human blood group A antigenicity along the digestive tract and associated glands in the rabbit. Cell Tissue Res. 239:241-245[Medline]. |
| 16. |
Guihard, G.,
P. Boulanger,
H. Bénédetti,
R. Lloubès,
M. Besnard, and L. Letellier.
1994.
Colicin A and the Tol proteins involved in its translocation are preferentially located in the contact sites between the inner and outer membranes of Escherichia coli cells.
J. Biol. Chem.
269:5874-5880 |
| 17. |
Isnard, M.,
A. Rigal,
J. C. Lazzaroni,
C. Lazdunski, and R. Lloubès.
1994.
Maturation and localization of the TolB protein required for colicin import.
J. Bacteriol.
176:6392-6396 |
| 18. |
Journet, L.,
A. Rigal,
C. Lazdunski, and H. Bénédetti.
1999.
Role of TolR N-terminal, central, and C-terminal domains in dimerization and interaction with TolA and TolQ.
J. Bacteriol.
181:4476-4484 |
| 19. | Koebnik, R. 1995. Proposal for peptidoglycan-associating alpha-helical motif in the C-terminal regions of some bacterial cell-surface proteins. Mol. Microbiol. 16:1269-1270[Medline]. |
| 20. | Laemmli, U. K. 1970. Cleavage of structural proteins during the assembly of the head of bacteriophage T4. Nature 227:680-685[Medline]. |
| 21. |
Lazdunski, C.,
E. Bouveret,
A. Rigal,
L. Journet,
R. Lloubès, and H. Bénédetti.
1998.
Colicin import into Escherichia coli cells.
J. Bacteriol.
180:4993-5002 |
| 22. |
Lazzaroni, J. C., and R. Portalier.
1981.
Genetic and biochemical characterization of periplasmic-leaky mutants of Escherichia coli K-12.
J. Bacteriol.
145:1351-1358 |
| 23. | Lazzaroni, J. C., and R. Portalier. 1992. The excC gene of Escherichia coli K12 required for cell envelope integrity encodes the peptidoglycan-associated lipoprotein (PAL). Mol. Microbiol. 6:735-742[Medline]. |
| 24. |
Lazzaroni, J. C.,
A. Vianney,
J. L. Popot,
H. Bénédetti,
F. Samatey,
C. Lazdunski,
R. Portalier, and V. Géli.
1995.
Transmembrane -helix interactions are required for the functional assembly of the Escherichia coli Tol complex.
J. Mol. Biol.
246:1-7[Medline].
|
| 25. | Leduc, M., D. Joseleau-Petit, and L. Rothfield. 1989. Interactions of membrane lipoproteins with the murein sacculus of Escherichia coli as shown by chemical cross-linking studies of intact cells. FEMS Microbiol. Lett. 60:11-14. |
| 26. |
Leduc, M.,
K. Ishidate,
N. Shakibai, and L. Rothfield.
1992.
Interactions of Escherichia coli membrane lipoproteins with the murein sacculus.
J. Bacteriol.
174:7982-7988 |
| 27. | Matsuyama, S., N. Yokota, and H. Tokuda. 1997. A novel outer membrane lipoprotein, LolB (HemM), involved in the LolA (p20)-dependent localization of lipoproteins to the outer membrane of Escherichia coli. EMBO J. 16:6947-6955[Medline]. |
| 28. |
Mizuno, T.
1979.
A novel peptidoglycan-associated lipoprotein found in the cell envelope of Pseudomonas aeruginosa and Escherichia coli.
J. Biochem.
86:991-1000 |
| 29. | Mizuno, T. 1981. A novel peptidoglycan-associated lipoprotein (Pal) of the Proteus mirabilis outer membrane: characterization of the peptidoglycan associated region of Pal. J. Biochem. 91:19-24. |
| 30. | Pautsch, A., and G. Schulz. 1998. Structure of the outer membrane protein A transmembrane domain. Nat. Struct. Biol. 5:1013-1017[Medline]. |
| 31. |
Rigal, A.,
E. Bouveret,
R. Lloubès,
C. Lazdunski, and H. Bénédetti.
1997.
The TolB protein interacts with the porins of Escherichia coli.
J. Bacteriol.
179:7274-7279 |
| 32. |
Rodriguez-Herva, J. J.,
M. I. Ramos-Gonzalez, and J. L. Ramos.
1996.
The Pseudomonas putida peptidoglycan-associated outer membrane lipoprotein is involved in maintenance of the integrity of the cell envelope.
J. Bacteriol.
178:1699-1706 |
| 33. | Sen, K., D. J. Sikkema, and T. F. Murphy. 1996. Isolation and characterization of the Haemophilus influenzae tolQ, tolR, tolA and tolB genes. Gene 178:75-81[Medline]. |
| 34. |
Sonntag, I.,
H. Schwartz,
Y. Hirota, and U. Henning.
1978.
Cell envelope and cell shape of Escherichia coli: multiple mutants missing the outer membrane lipoprotein and other major outer membrane proteins.
J. Bacteriol.
136:280-285 |
| 35. |
Towbin, H.,
T. Staehelin, and J. Gordon.
1979.
Electrophoretic transfer of proteins from polyacrylamide gels to nitrocellulose sheets: procedure and some applications.
Proc. Natl. Acad. Sci. USA
76:4350-4354 |
| 36. |
Vianney, A.,
M. Muller,
J. Clavel,
J. C. Lazzaroni,
R. Portalier, and R. E. Webster.
1996.
Characterization of the tol-pal region of E. coli K-12: translational control of tolR expression by TolQ and identification of a new open reading frame downstream of pal encoding a periplasmic protein.
J. Bacteriol.
178:4031-4038 |
| 37. |
Zlotnick, G. W.,
V. T. Sanfilippo,
J. A. Mattler,
D. H. Kirkley,
R. A. Boykins, and R. C. Seid, Jr.
1988.
Purification and characterization of a peptidoglycan-associated lipoprotein from Haemophilus influenzae.
J. Biol. Chem.
263:9790-9794 |
This article has been cited by other articles:
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Copyright © 2009 by the American Society for Microbiology. For an alternate route to Journals.ASM.org, visit: http://intl-journals.asm.org | More Info»