Previous Article | Next Article ![]()
Journal of Bacteriology, March 1999, p. 1403-1408, Vol. 181, No. 5
Departments of
Biochemistry1 and Biological
Sciences,2 Purdue University, West
Lafayette, Indiana 47907
Received 8 September 1998/Accepted 16 December 1998
Glutamine phosphoribosylpyrophosphate amidotransferase from
Bacillus subtilis is a member of an N-terminal
nucleophile hydrolase enzyme superfamily, several of which undergo
autocatalytic propeptide processing to generate the mature active
enzyme. A series of mutations was analyzed to determine whether amino
acid residues required for catalysis are also used for propeptide
processing. Propeptide cleavage was strongly inhibited by
replacement of the cysteine nucleophile and two residues of an oxyanion
hole that are required for glutaminase function. However, significant
propeptide processing was retained in a deletion mutant with
multiple defects in catalysis that was devoid of enzyme activity.
Intermolecular processing of noncleaved mutant enzyme subunits by
active wild-type enzyme subunits was not detected in hetero-oligomers
obtained from a coexpression experiment. While direct in vitro evidence
for autocatalytic propeptide cleavage was not obtained, the results
indicate that some but not all of the amino acid residues that have a
role in catalysis are also needed for propeptide processing.
Glutamine
phosphoribosylpyrophosphate (PRPP) amidotransferase is the key
regulatory enzyme of de novo purine nucleotide synthesis. Genes
encoding the enzyme have been cloned from more than 20 organisms, including bacteria, archaea, and eucarya (30). However, only the enzymes from Bacillus subtilis and
Escherichia coli have been purified to homogeneity and
characterized biochemically. X-ray structures have been determined for
the B. subtilis (27) and E. coli
(22) enzymes. The B. subtilis and E. coli enzymes are representative of two distinctive but homologous
glutamine PRPP amidotransferase classes. Enzymes of the B. subtilis class are synthesized with an N-terminal propeptide and,
in addition, acquire an Fe-S cluster. Enzymes of the E. coli
class have neither a propeptide nor an Fe-S cluster. Cleavage of the
propeptide is essential for generating the active enzyme containing an
N-terminal cysteine that functions as a nucleophile in catalysis.
Brannigan et al. (2) initially recognized that three
structurally defined amidohydrolases Thus far, it has not been possible to detect processing of
B. subtilis glutamine PRPP amidotransferase
proenzyme in vitro (16). In this study we have sought to
determine whether amino acids that are required for glutamine PRPP
amidotransferase catalysis also have a role in propeptide processing.
Glutamine PRPP amidotransferase catalyzes the synthesis
of phosphoribosylamine (PRA) from PRPP and glutamine or
NH3 as shown by the following equations.
0021-9193/99/$04.00+0
Copyright © 1999, American Society for Microbiology. All rights reserved.
Mutational Analysis of Bacillus subtilis
Glutamine Phosphoribosylpyrophosphate Amidotransferase Propeptide
Processing
![]()
ABSTRACT
Top
Abstract
Introduction
Materials and Methods
Results
Discussion
References
![]()
INTRODUCTION
Top
Abstract
Introduction
Materials and Methods
Results
Discussion
References
penicillin acylase, the 20S
proteasome, and B. subtilis glutamine PRPP
amidotransferase
share a common fold in which the N-terminal
nucleophile and other catalytic groups occupy equivalent sites. These
enzymes, as well as glycosylasparaginase (23), comprise an
N-terminal nucleophile (Ntn) hydrolase structural superfamily. Several
of the Ntn hydrolases are synthesized as inactive proenzymes that are
posttranslationally processed to generate the mature active enzyme with
an N-terminal nucleophile. Several reports have provided strong
evidence that 20S proteasome
subunits (3, 12, 21, 26)
and glycosylasparaginase (9-11, 29) undergo autocatalytic
proenzyme processing. For B. subtilis glutamine PRPP
amidotransferase (18, 28) and penicillin acylase (6), the possibility of autocatalytic propeptide cleavage
has been suggested from observations that expression of cloned genes in
a different host results in active enzyme and that mutations distant
from the cleavage site can prevent processing.
The mature enzyme contains two domains (30). An
N-terminal glutamine domain converts glutamine to glutamate plus
NH3. The C-terminal phosphoribosyltransferase (PRTase)
domain binds PRPP and utilizes NH3 derived from glutamine
or supplied externally for the synthesis of PRA. Binding of PRPP is
required for glutamine hydrolysis. PRPP binding results in
conformational changes that shield the PRPP site from solvent,
restructure the glutamine site, and form a 20-Å channel which connects
the glutamine and PRTase sites and serves as a route for
NH3 transfer (14). The mutational analysis in
this study indicates that some but not all elements of catalysis are
required for propeptide processing.
| |
MATERIALS AND METHODS |
|---|
|
|
|---|
Strains and plasmids. E. coli BL834(DE3) (7) was used for the expression of wild-type and mutant purF genes. For site-directed mutagenesis, genes were cloned into plasmids pUC118 or pET14b. Plasmids pTrc99A and pT7-7 were used as vectors for enzyme production. Other specialized plasmids that were constructed for this work are described in the following sections.
Construction of plasmids to analyze propeptide processing. To increase the length of the glutamine PRPP amidotransferase propeptide, the B. subtilis purF gene was first cloned into pET14b (Novagen). Plasmid pGZ1, which contains B. subtilis purF in a 1.65-kb EcoRI-HindIII fragment in pUC18 (19) was the template for a PCR reaction in which an NdeI site was incorporated into the ATG translation start site and a BamHI site downstream of the gene for transcription termination. The NdeI-BamHI PCR product was ligated into the corresponding sites of pET14b. Digestion with NcoI-BamHI released a 1.5-kb purF gene containing a 20-codon 5' extension. The fragment was ligated into pTrc99A to yield plasmid pTrcBF. To add a C-terminal His tag, an NcoI-HindIII purF fragment was transferred from pTrcBF to a pUC118 derivative containing an NcoI site (pUCNco). The His tag was added by site-directed mutagenesis (15) with the oligonucleotide, 5'-CTTGCATGCCTGCAGTTAGTGGTGGTGGTGGTGGTGGGATCCTTCTTTGGTTAATACTGC (histidine codons are underlined) to yield plasmid pUCBFc. Further purF site-directed mutagenesis to examine the roles of residues in propeptide processing was carried out with plasmid pUCBFc.
A PCR reaction was used to delete the PRTase flexible loop: residues Leu303 to Leu329 (27). Plasmid pUCBFc was the DNA template. The primers were 5'-GGTGGTGCTAGCCCCGCCAAGCTCATACGGAATGCC and 5'-GGTGGTGCTAGCGGCTCTGCGGTGGGCGGGGTTGTA, each containing an NheI site (underlined). The 4.5-kb PCR product was isolated by using a Qiagen PCR purification kit and then digested with NheI and self-ligated. The sequence change is shown: wild type, (302) GLIKNRYVGRTFIQPSQALREQGVRMKLSA (331); deletion, (302) GGAS SA (307) The resulting plasmid was named pUC(
loop)c. All
mutations were confirmed by sequencing (24) the 100 to 200 bp overlapping the position of the mutation. Confirmed plasmids were
digested with NcoI-HindIII, and the 1.5-kb
purF fragment was returned to pTrc99A for enzyme production.
The plasmid designations are pTrcBFc for
purF+, pTrc(
loop)c, pTrc(N102D)c,
pTrc(H25Q)c, pTrc(H70Y)c, pTrc(H70N)c, and pTrc(H101Q)c.
Deletion of the propeptide for measurement of enzyme
activity.
For measurement of enzyme activity, codons for the
propeptide were deleted from the purF gene in plasmids
pUCBFc, pUC(
loop)c, pUC(N102D)c, pUC(H25Q)c, pUC(H70Y)c,
pUC(H70N)c, and pUC(H101Q)c. First, an NdeI site was
introduced at the position of the translation initiation codon of the
mature enzyme by site-directed mutagenesis (15). Next,
each plasmid was digested with
NdeI-HindIII, and the inserts were
transferred to pT7-7. The resulting plasmids were designated
P/H6 (wild type with His tag),
P(
loop)H6,
P(N102D)H6,
P(H25Q)H6,
P(H70N)H6,
P(H70Y)H6, and
P(H101Q)H6.
Construction of a coexpression system.
Plasmids containing a
bicistronic operon containing mutant purF
followed by active purF were constructed by the following steps. First, an XbaI site was introduced at the 3' end of
pUC(N102D)c by site-directed mutagenesis (15). The
NcoI-XbaI purF fragment from
pUC(N102D)c and XbaI-HindIII-cut
wild-type purF DNA from pT7BF were mixed and ligated into
pTrc99A that had been digested with
NcoI-HindIII. The resulting coexpression
plasmid pTrc(N102D)c-wt contained purF with a N102D
mutation, a 31-codon propeptide sequence, and a 3' six-histidine codon
sequence followed by a wild-type purF gene. A second
coexpression plasmid was constructed in which the downstream wild-type
purF was replaced with purF+
containing a propeptide deletion. Wild-type purF was excised from pTrc(N102D)c-wt by digestion with
XbaI-HindIII and was replaced with the
corresponding purF+ fragment containing a
propeptide deletion from pT7BF
. The bicistronic plasmid was named
pTrc(N102D)c-
wt.
Enzyme production and purification. Wild-type and mutant purF genes were expressed in E. coli BL834(DE3). Plasmid-bearing cells were initially grown in 5 ml of Luria-Bertani medium containing 100 µg of ampicillin per ml at 37°C. A portion (1 ml) of overnight culture was used to inoculate 250 ml of the same medium. The cells were grown at 30°C for 15 h, harvested by centrifugation, and suspended in 10 ml of buffer A (20 mM Tris-HCl, pH 8.0; 100 mM NaCl; 2 mM AMP). All buffers used for enzyme purification were sparged with nitrogen gas prior to use to minimize oxidation of the enzyme's Fe-S cluster. The cells were broken with a French press at 1,000 lb/in2, and cell debris was removed by centrifugation at 27,000 × g for 30 min. Glutamine PRPP amidotransferase was purified by metal chelate affinity chromatography with Talon Co2+ affinity resin (Clontech) according to the protocol recommended by the supplier. Briefly, 8 ml of extract was incubated with 2 ml of resin for 20 min at 4°C. After being washed with 20 ml of buffer A two times, the resin was packed into two small columns. Enzyme from each column was eluted with 3 ml of buffer A containing 100 mM imidazole. The last 2 ml of eluant was collected and concentrated with a Centricon. After addition of 2 ml of buffer (50 mM Tris-HCl, pH 7.5; 2 mM AMP), the enzyme was concentrated again. First, 1 ml of 50 mM Tris-HCl (pH 7.5) was added, and then the sample was centrifuged to a final volume of 150 to 200 µl. Protein concentration was determined (1) by using bovine serum albumin as a standard. The enzyme was purified to approximately 90% homogeneity as judged by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE). The yield was 5 to 6 mg of protein per 250 ml of culture.
Enzyme assay. Activity with glutamine as a substrate was determined by measuring the production of glutamate as described earlier (4). Activity with NH3 as a substrate was determined by coupling PRA production to the synthesis of glycinamide ribonucleotide with glycinamide ribonucleotide synthetase (25). A unit of activity is defined as the amount of enzyme forming 1 µmol of product/min at 37°C. Specific activity is given as units per milligram of protein.
Assays for propeptide processing. In preliminary experiments, propeptide processing was assayed by using enzymes with the normal 11-amino-acid propeptide and no His tag. Wild-type B. subtilis enzyme was produced in E. coli B834(DE3) from pET-BsF (5) or the corresponding plasmids with R72A or D127A amino acid replacements. Cells were grown as previously described, and proteins in cell lysates were resolved by SDS-PAGE (5). Proteins were transferred to a polyvinylidine membrane, and 5 to 10 cycles of Edman degradation were determined from the protein band containing incompletely resolved proenzyme and mature enzyme. The relative amounts of proenzyme and mature enzyme were calculated from the amino acid quantitation averaged over at least five cycles of degradation.
Except for the preliminary experiments just described, propeptide processing was evaluated by using wild-type and mutant enzymes modified with a 31-amino-acid propeptide and a C-terminal His tag. Cells were grown and enzyme was isolated as described above. Proenzyme and mature enzyme were resolved by SDS-8% PAGE (5).| |
RESULTS |
|---|
|
|
|---|
Analysis of glutamine PRPP amidotransferase propeptide processing. Two modifications were incorporated into glutamine PRPP amidotransferase in order to facilitate the analysis of propeptide processing by SDS-PAGE. First, the length of the propeptide was extended to improve the electrophoretic separation of the precursor from the mature enzyme. The B. subtilis glutamine PRPP amidotransferase propeptide was increased from 11 to 31 amino acids by fusing a 20-amino-acid peptide to the N terminus of the proenzyme. With this increased mass of 2.18 kDa there was improved electrophoretic resolution of the 53.8-kDa proenzyme and the 50.4-kDa mature species. Second, a C-terminal His tag was added to permit a rapid one-step enzyme purification. The main problem in assessing propeptide processing from crude cell extracts by SDS-PAGE was the background of E. coli proteins of 50 to 60 kDa, which interfered with the identification of the precursor and mature forms of the amidotransferase. By using the C-terminal His tag, the precursor and mature glutamine PRPP amidotransferase species could be rapidly separated from E. coli proteins by a one-step affinity purification step.
The SDS-gel electrophoresis profiles in Fig. 1 show the resolution of the modified wild-type enzyme (lane 1) from three largely unprocessed mutants in lanes 2 to 4. As shown in Fig. 1, lane 1, there was essentially complete propeptide processing of the modified B. subtilis enzyme overproduced in E. coli. Therefore, neither the propeptide extension nor the C-terminal His tag adversely affected propeptide processing.
|
Relationship between enzyme catalysis and propeptide processing. We have mutated amino acid residues that participate in catalysis in order to determine the relationship between the amino acids required for enzyme catalysis and those needed for propeptide processing. There are four initial steps in catalysis that are necessary for the hydrolysis of glutamine and amide transfer to form PRA (30). These steps are (i) enzyme activation by PRPP, (ii) covalent catalysis by Cys1, (iii) stabilization of a tetrahedral glutaminyl oxyanion, and (iv) general acid-base catalysis. Mutations were constructed to disable each of these steps, and their effect on propeptide processing was determined.
(i) Enzyme activation by PRPP.
The key structural change in
the transition from inactive to active enzyme is an ordering of a
PRTase domain flexible loop (14). PRPP binding triggers the
flexible loop to close the site and sequester the bound PRPP from the
solvent. The rearranged PRTase loop also contributes to the formation
of a 20-Å channel that connects the glutamine and PRPP sites. To
examine the relationship between enzyme activation and propeptide
processing, a deletion of residues 303 to 329 that removes most of the
flexible loop was constructed. In order to assess the effects of
mutations on catalysis, independent of the requirement for propeptide
cleavage, it was necessary to delete the sequence encoding the
propeptide from the cloned purF gene. Table
1 shows the results of a wild-type control to compare the enzyme activity of the native wild-type amidotransferase and the enzyme synthesized without a propeptide and containing a C-terminal His tag (designated
P/H6) for rapid purification. The two enzymes had identical activities with glutamine, although the modifications reduced the activity with NH3.
Since the assay of NH3-dependent activity involves a
coupling reaction with GAR synthetase, one possibility is that the
C-terminal His tag interferes with coupling, thus accounting for the
reduced NH3-dependent activity of the modified enzyme.
Table 1 also shows that deletion of the PRTase domain flexible loop
abolished all activity in the
P(
loop)/H6 enzyme, as expected for
a mutation that should disrupt the PRPP site and prevent the transition
of the inactive to active conformer.
|
loop/H6 enzyme
with the flexible loop deletion was approximately 50% processed. The
upper band in Fig. 2, lane 1, corresponds to unprocessed proenzyme.
The electrophoretic migration of this proenzyme was similar
to that of a processed H70N/H6 amidotransferase mutant
(lane 2), a finding which is consistent with their similar
masses. These results indicate that the inactive conformer,
lacking an intact PRPP site and residues that are needed for the
NH3 channel that connects the glutamine and PRPP sites, can
undergo propeptide processing. The glutamine- and
NH3-dependent catalytic activities therefore do not have an
obligatory role in propeptide processing.
|
(ii) Covalent catalysis by Cys1. The role of Cys1 in catalysis is nucleophilic attack on the carboxamide of glutamine to form a tetrahedral oxyanion intermediate (30). In light of the capacity of an N-terminal threonine to function as a nucleophile in other Ntn hydrolases (8-11, 17), a C1T mutant amidotransferase was constructed. The C1T mutant enzyme had no detectable activity with glutamine or with NH3 and, as shown in Fig. 1, lane 2, the proenzyme was completely unprocessed. Previous work has shown that C1F (20) and C1S (28) mutant enzymes are not processed and have no activity with glutamine. The C1F mutant retained about 40% of NH3 activity relative to the wild type, whereas the C1S enzyme had about 1% of the wild-type activity.
(iii) Stabilization of the tetrahedral glutaminyl oxyanion.
According to the current mechanism (30), attack of Cys1
thiolate on the C
of glutamine results in formation of a
covalent enzyme-glutaminyl intermediate. In the E. coli glutamine PRPP amidotransferase, the resulting
tetrahedral oxyanion is stabilized by hydrogen bonds to N
of Asn101
and the backbone NH of Gly102 (13). The corresponding
residues in the B. subtilis amidotransferase are Asn102
and Gly103. Data in Table 1 show nearly complete loss of activity with
glutamine in the N102D mutant B. subtilis enzyme, whereas activity with NH3 is comparable to that for the
P/H6 parent enzyme. This result points to similar oxyanion
stabilization in the B. subtilis and E. coli enzymes. The activity of a G103A mutant enzyme was not
determined but is expected to have a similar defect in
glutamine-dependent activity, as seen for the E. coli glutamine PRPP amidotransferase (13). This conclusion is
based on the fact that the atomic positions of all catalytic residues are identical within experimental error in the glutamine domain of the
two enzymes (22). The data in Fig. 1 (lanes 3 and 4) indicate a strong inhibition of propeptide processing in N102D and G103A mutants. These results suggest that the oxyanion hole that participates in catalysis also has a role in propeptide processing.
(iv) General acid or base catalysis.
A general acid or base
group is required for two steps in catalysis at the glutamine site.
First, a proton is donated to the leaving amide to yield
NH3 upon collapse of the tetrahedral oxyanion intermediate
and, second, a proton is accepted from water to generate hydroxyl ion
for hydrolysis of the resultant thioester and the release of glutamate.
Because no appropriate amino acid side chains are in close enough
proximity to Cys1 in the X-ray structures of the inactive conformer of
the B. subtilis enzyme nor in the active state of the
E. coli enzyme, the proposal was made that the
-amino group of Cys1 functions as a proton donor or acceptor (30). The
-amino group of Cys1 is suitably positioned to
mediate proton transfers directly or via a bridging H2O
molecule. A general acid or base is also needed for the steps of
propeptide cleavage, yet the
-amino group of Cys1 is in peptide
linkage and is therefore not available to assume this function. To
search for a potential amino acid side chain that might function as a
proton acceptor and donor in propeptide cleavage, we examined
propeptide processing in a series of mutants. Each of the three
conserved histidine residues in the glutamine domain and two conserved
glutamate residues in the propeptide were targeted for mutagenesis. The
gel profile in Fig. 3 shows the results
for propeptide processing in these mutants. Of the three conserved
histidines, only His70 was necessary to maintain propeptide processing.
H70Y and H70N mutant enzymes were largely unprocessed. On the other
hand, H25Q and H101Q mutations had little if any effect on propeptide
processing. Of several replacements for Glu
2, an E
2G
amidotransferase was about 50% processed. Glu
2 refers to amino acid
position minus two in the propeptide, numbered relative to Cys1 in the
mature enzyme. Intermediate levels of propeptide processing were also
seen for enzymes with E
2D, E
2H, and E
2Q replacements (data
not shown). An E
2G E
1A double mutant was also about 50%
processed. These results indicate that Glu
2 and Glu
1 have no
obligatory role in propeptide processing and are thus not likely to
function as general acid/base groups in the reaction. The role of His70
is uncertain.
|
P/H6 parent in each of these
mutant enzymes.
Substrate binding. Arg73 and Asp127 are key residues required for glutamine binding to E. coli glutamine PRPP amidotransferase (13). The corresponding B. subtilis amidotransferase residues (Arg72 and Asp127) were replaced to determine if the site for glutamine binding was required for propeptide processing. These experiments were carried out with enzymes having the wild-type 11-amino-acid propeptide and no C-terminal His tag. After SDS-PAGE, proteins were transferred to a polyvinylidine difluoride membrane, and N-terminal sequences were determined for incompletely resolved proenzyme and mature enzyme. By this method there was 91% processing for wild-type, 77% for R72A, and 67% for D127A enzymes. An intact glutamine binding site is thus not required for propeptide processing.
A test of intermolecular processing. The requirement for several catalytic residues to convert proenzyme into mature enzyme points to an autocatalytic propeptide processing mechanism. Autocatalysis could be intra- or intermolecular. A test of intermolecular autocatalysis was carried out in vivo by determining if wild-type subunits were able to cleave propeptide from a mutant subunit during or after assembly of hetero-oligomeric enzyme. Two plasmids were constructed for this experiment. The first, pTrc(N102D)c-wt, encodes in a bicistronic operon the N102D mutant enzyme with a 31-amino-acid propeptide plus a C-terminal His tag followed by the native wild-type amidotransferase containing the natural 11-amino-acid propeptide. The second plasmid is similar except the gene encoding the native wild type was replaced with one encoding wild-type enzyme without a propeptide. Coexpression of the two genes was designed to produce hetero-oligomers that could be purified by using the His tag on the N102D subunit. Lanes 1 to 3 in Fig. 4 show the results of N102D coexpression with wild-type purF, and lanes 4 to 6 show coexpression in which wild-type purF lacked codons for the propeptide. Two protein bands from the cell extract were identified in lane 1. The top band corresponds to unprocessed N102D subunit with the His tag, and the lower band corresponds to the mature enzyme subunit, either wild type or N102D. It is not possible to distinguish whether the mature subunit in lane 1 is wild type or N102D without the further analysis shown in lanes 2 and 3. Lane 2 shows the composition of the enzyme when affinity purified under native conditions. The upper band is the N102D proenzyme subunit, and the lower band is the mature subunit, either wild type (no His tag) or N102D with the His tag. To determine whether there was any mature N102D subunit in the lower band, the purified enzyme was denatured in 8 M urea, isolated by affinity chromatography, and electrophoresed in lane 3. The result in lane 3 shows that after denaturation, only proenzyme subunits were purified. Thus, there were no detectable mature N102D subunits in the lower band in lane 2. Very similar results, shown in lanes 4 to 6, were obtained for the coexpression of genes encoding N102D proenzyme and wild-type amidotransferase synthesized without a propeptide. Based on the relative staining of the bands in lanes 2 and 5 corresponding to the proenzyme subunit and the mature enzyme subunit, it would appear that the hetero-oligomer stoichiometry was likely one N102D proenzyme and three mature wild-type subunits. This stoichiometry is in accord with the construction of the bicistronic operon that was designed to yield a higher synthesis rate for wild-type subunits resulting from a stronger ribosome binding site as outlined in Materials and Methods. This experiment demonstrates that the precursor N102D mutant subunit has sufficient native structure to form hetero-oligomers with wild-type subunits but that active wild-type subunits could not catalyze trans propeptide cleavage of the N102D propeptide under these conditions.
|
| |
DISCUSSION |
|---|
|
|
|---|
Since we have not detected glutamine PRPP amidotransferase
propeptide processing in vitro (16), further
characterization of enzyme maturation in cells should prove useful. An
objective of this work was to determine if cleavage of the propeptide
amide bond requires the same catalytic groups as glutamine amide
hydrolysis, an initial step in the reaction to synthesize PRA. The
interpretation of these results leads to the conclusion that some,
although not all, of the residues needed for glutamine hydrolysis are
involved in propeptide cleavage, as explained in the discussion that
follows. Binding of PRPP to its catalytic site activates
glutamine hydrolysis by structural changes that lower the
Km for glutamine by 100-fold and increase
the Vm by 3-fold (13). A deletion of
residues which in the nonactive conformer comprises a PRTase
flexible loop and are needed to form a functional PRPP site, a
functional glutaminase site, and the channel to connect the two sites
abolished glutaminase activity and NH3-dependent
synthesis of PRA, as shown in Table 1. Yet, as seen in Fig. 1,
approximately one-half of this mutant enzyme was processed.
Therefore, a functional glutaminase site is not obligatory for
propeptide cleavage. On the other hand, the perturbations in this
mutant of the glutamine site could explain the approximately 50%
inhibition of propeptide processing. Cys1, the Ntn, and Asn102 plus
Gly103, residues that provide oxyanion stabilization, are two
components of enzyme catalysis that are clearly necessary for
propeptide processing (Fig. 1). It would therefore appear that these
residues retain some capacity to function in propeptide cleavage in the
PRTase flexible loop deletion. The role of Cys1 in catalysis is
nucleophilic attack on the carboxamide of glutamine to yield a
tetrahedral oxyanion intermediate. This intermediate is stabilized by
interactions with the amide side chain of Asn102 and the backbone NH of
Gly103. It is therefore reasonable to conclude that the Cys1 thiolate
performs a similar nucleophilic attack on the peptide bond between
Glu
1 and Cys1. The resulting tetrahedral oxyanion might be
stabilized by interactions with Asn102 and Gly103. The partial
inhibition of propeptide processing by the PRTase flexible loop
deletion suggests that the repositioning of active-site residues by
PRPP binding that is essential for glutamine hydrolysis increases the
efficiency of propeptide cleavage but is not obligatory. Glutamine
binding is unlikely to have a role in propeptide processing, since
mutations that increase the Km for glutamine by
60- to 130-fold had only small effects on propeptide cleavage.
To complete the peptide bond cleavage by this proposed mechanism
general acid and general base groups are required to protonate the NH
of Cys1 upon cleavage of the backbone and to accept a proton from
H2O to generate the hydroxyl ion needed for thioester
hydrolysis, respectively. In the structure-based mechanism for
catalysis the free
-amino group of the N-terminal cysteine is
proposed to carry out the comparable proton transfer steps for
glutamine hydrolysis (30). However, since the
-amino of
Cys1 is in peptide linkage in the proenzyme it is unavailable to
function as a general acid or base group. We investigated whether
conserved histidine or glutamate side chains might carry out this
function. Of three conserved histidines in the glutamine domain, only
replacement of His70 had a major effect on propeptide cleavage. It is
uncertain, however, whether His70 could have a direct role as a general
base and acid group in propeptide cleavage. This is because glutaminase function was inhibited in the two His70 mutants in parallel with the
inhibition of propeptide cleavage. Since there is no presently known
direct role for His70 in the structure-based catalytic mechanism (30), its replacement may indirectly affect catalysis and by analogy indirectly affect propeptide cleavage. Essential roles of the two highly conserved glutamate residues at positions
1 and
2
in the propeptide are unlikely, as shown by the significant processing
that was retained in the Glu
1 Glu
2 mutant enzyme. The question of
the general acid or base group needed for propeptide cleavage is
therefore unresolved.
Direct evidence for autocatalytic processing has been obtained for two
Ntn hydrolases, glycosylasparagenase (9, 10, 29) and the 20S
proteasome (3, 21, 26). The amino acid residue in the
2
position of Flavobacterium meningosepticum
glycosylasparaginase (His150) was shown to be required for
intermolecular autoproteolysis and is assumed to function as the base
that activates Thr152 for nucleophilic attack on the Asp151 peptide
backbone (9, 10). The resulting cleavage of the proenzyme
generates an active
subunit with an N-terminal threonine. The acid
or base group required for this step has not been identified. Thr152
O
functions as the nucleophile and the
-amino group as the
base for amidohydrolase catalysis. The backbone NH of Gly204
and perhaps Thr203 O
make up the oxyanion hole (11,
23, 29).
A number of in vitro and in vivo experiments have provided strong
evidence for the autocatalytic processing of proteosome
subunits
(21, 26), which are assembled into a hetero-oligomeric (
7)2(
7)2
barrel-shaped structure (8, 17). Each of the seven precursor
subunits from these enzymes are identical, and they are processed
intermolecularly during folding and assembly of the
(
7)2(
7)2
hetero-oligomer. Thr1 is the N-terminal nucleophile for processing
and for catalysis. The
-amino group of Thr1 is implicated as the
base for catalysis and is possibly assisted by Lys33. However, the base
used for propeptide cleavage has not been defined for the archaea
enzymes. In the more complex yeast proteasome, with seven different
subunits, propeptide cleavages can occur by intra- and
intermolecular mechanisms (8, 12). A structure-based
mechanism for intramolecular propeptide cleavage invokes Thr1 as a
nucleophile and a water molecule as a general base for activation of
Thr1 and for cleavage of the peptide bond (8). Lys33 N
and Gly47N are correctly positioned to function as an oxyanion hole.
Our experiments did not detect processing of an inactive N102D
proenzyme by an active wild-type glutamine PRPP amidotransferase when
genes for the two enzymes were coexpressed from a bicistronic operon.
Inactive Thermoplasma proteasome
subunits were processed by active subunits in an experiment of similar design
(26). Once they were assembled into
7 and
7 ring structures, no further processing took place. It
was concluded that processing probably occurs before
subunits have
reached their final folded state and are assembled into proteosomes.
Glutamine PRPP amidotransferase is also processed prior to the
formation of stable dimers or tetramers. Highly expressed wild-type
enzyme is a mixture of processed and unprocessed subunits
(5). Further processing was not observed in cells incubated
for extended periods of time or in cell extracts incubated in the
presence or absence of oxygen.
| |
ACKNOWLEDGMENTS |
|---|
This work was supported by Public Health Service grants GM24658 (H.Z.) and DK42303 (J.L.S.). Protein sequencing was carried out by the Purdue Laboratory for Macromolecular Structure, which is supported by the Diabetes Research and Training Center (Public Health Service grant DK20542).
We thank Sihong Chen for help with enzyme assays and for sharing her expertise with the enzyme, and we thank Jay Bertrand for structural insights.
| |
FOOTNOTES |
|---|
* Corresponding author. Mailing address: Department of Biochemistry, Purdue University, West Lafayette, IN 47907. Phone: (765) 494-1618. Fax: (765) 494-7897. E-mail: zalkin{at}biochem.purdue.edu.
Journal paper 15893 from the Purdue University Agricultural
Experiment Station.
| |
REFERENCES |
|---|
|
|
|---|
| 1. | Bradford, M. M. 1976. A rapid and sensitive method for the quantitation of microgram quantities of protein utilizing the principle of protein-dye binding. Anal. Biochem. 72:248-254[Medline]. |
| 2. | Brannigan, J. A., G. Dodson, H. J. Duggleby, P. C. E. Moody, J. L. Smith, D. R. Tomchick, and A. G. Murzin. 1995. A protein catalytic framework with an N-terminal nucleophile is capable of self-activation. Nature 378:416-419[Medline]. |
| 3. | Chen, P., and M. Hochstrasser. 1996. Autocatalytic subunit processing couples active site formation in the 20S proteasome to completion of assembly. Cell 86:961-972[Medline]. |
| 4. | Chen, S., D. R. Tomchick, D. Wolle, P. Hua, J. L. Smith, R. L. Switzer, and H. Zalkin. 1997. Mechanism of the synergistic end-product regulation of Bacillus subtilis glutamine phosphoribosylpyrophosphate amidotransferase by nucleotides. Biochemistry 36:10718-10726[Medline]. |
| 5. |
Chen, S.,
L. Zheng,
D. R. Dean, and H. Zalkin.
1997.
Role of Nifs in maturation of glutamine phosphoribosyltransferase.
J. Bacteriol.
179:7587-7590 |
| 6. |
Choi, K. S.,
J. A. Kim, and H. S. Kang.
1972.
Effects of site-directed mutations on processing and activities of penicillin G acylase from Escherichia coli ATCC 11105.
J. Bacteriol.
174:6270-6276 |
| 7. |
Doherty, A. J.,
S. R. Ashford,
J. A. Brannigan, and D. B. Wigley.
1995.
A superior host strain for the overexpression of cloned genes using the T7 promoter based vectors.
Nucleic Acids Res.
23:2074-2075 |
| 8. | Groll, M., L. Ditzel, J. Löwe, D. Stock, M. Bochtler, H. D. Bartunik, and R. Huber. 1997. Structure of the 20S proteasome from yeast at 2.4 Å resolution. Nature 386:463-471[Medline]. |
| 9. | Guan, C., T. Cui, V. Rao, W. Liao, J. Benner, C.-L. Lin, and D. Comb. 1996. Activation of glycosylasparaginase. Formation of active N-terminal threonine by intramolecular autoproteolysis. J. Biol. Chem. 271:1731-1737. |
| 10. |
Guan, C.,
Y. Liu,
Y. Shao,
T. Cui,
W. Liao,
A. Ewel,
R. Whitaker, and H. Paulus.
1998.
Characterization and functional analysis of the cis-autoproteolysis active center of glycosylasparaginase.
J. Biol. Chem.
273:9695-9702 |
| 11. |
Guo, H.-C.,
Q. Xu,
D. Buckley, and C. Guan.
1998.
Crystal structures of Flavobacterium glycosylasparaginase. An N-terminal nucleophile hydrolase activated by intramolecular proteolysis.
J. Biol. Chem.
273:20205-20212 |
| 12. |
Heinemeyer, W.,
M. Fischer,
T. Krimmer,
U. Stachon, and D. H. Wolf.
1997.
The active sites of the eukaryotic 20S proteasome and their involvement in subunit precursor processing.
J. Biol. Chem.
272:25200-25209 |
| 13. |
Kim, J. H.,
J. M. Krahn,
D. R. Tomchick,
J. L. Smith, and H. Zalkin.
1996.
Structure and function of the glutamine phosphoribosylpyrophosphate amidotransferase glutamine site and communication with the phosphoribosylpyrophosphate site.
J. Biol. Chem.
271:15549-15557 |
| 14. | Krahn, J. M., J. H. Kim, M. R. Burns, R. J. Parry, H. Zalkin, and J. L. Smith. 1997. Coupled formation of an amidotransferase interdomain ammonia channel and a phosphoribosyltransferase active site. Biochemistry 36:11061-11068[Medline]. |
| 15. | Kunkel, T. A., J. D. Roberts, and R. A. Koukour. 1987. Rapid and efficient site-specific mutagenesis without phenotypic selection. Methods Enzymol. 154:367-382[Medline]. |
| 16. | Li, S., and H. Zalkin. 1998. Unpublished results. |
| 17. |
Löwe, J.,
D. Stock,
B. Jap,
P. Zwicki,
W. Baumeister, and R. Huber.
1995.
Crystal structure of the 20S proteasome from the archaeon T. acidophilum at 3.4Å resolution.
Science
268:533-539 |
| 18. |
Makaroff, C. A.,
J. L. Paluh, and H. Zalkin.
1986.
Mutagenesis of ligands to the [4Fe-4S] center of Bacillus subtilis glutamine phosphoribosylpyrophosphate amidotransferase.
J. Biol. Chem.
261:11416-11423 |
| 19. |
Makaroff, C. A.,
H. Zalkin,
R. L. Switzer, and S. J. Vollmer.
1983.
Cloning of Bacillus subtilis glutamine phosphoribosylpyrophosphate amidotransferase gene in Escherichia coli. Nucleotide sequence determination and properties of the plasmid-encoded enzyme.
J. Biol. Chem.
258:10586-10593 |
| 20. |
Mäntsälä, P., and H. Zalkin.
1984.
Glutamine amidotransferase function. Replacement of the active site cysteine in glutamine phosphoribosylpyrophosphate amidotransferase by site-directed mutagenesis.
J. Biol. Chem.
259:14230-14236 |
| 21. |
Maupin-Furlow, J. A.,
H. C. Aldrich, and J. G. Ferry.
1998.
Biochemical characterization of the 20S proteasome from the methanoarchaeon Methanosarcina thermophila.
J. Bacteriol.
180:1480-1487 |
| 22. | Muchmore, C. R. A., J. M. Krahn, J. H. Kim, H. Zalkin, and J. L. Smith. 1998. Crystal structure of glutamine phosphoribosylpyrophosphate amidotransferase from Escherichia coli. Protein Sci. 7:39-51[Medline]. |
| 23. | Oinonen, C., R. Tikkanen, J. Rouvinen, and L. Peltonen. 1995. Three-dimensional structure of human lysosomal aspartylglucosaminidase. Nat. Struct. Biol. 2:1102-1108[Medline]. |
| 24. |
Sanger, F.,
S. Nicklen, and A. R. Coulson.
1977.
DNA sequencing with chain-terminating inhibitors.
Proc. Natl. Acad. Sci. USA
74:5463-5467 |
| 25. | Schendel, F. J., Y. S. Cheng, J. D. Otvos, S. Wehrli, and J. Stubbe. 1988. Characterization and chemical properties of phosphoribosylamine, an unstable intermediate in the de novo purine biosynthetic pathway. Biochemistry 27:2614-2623[Medline]. |
| 26. | Seemüller, E., A. Lupas, and W. Baumeister. 1996. Autocatalytic processing of the 20S proteasome. Nature 382:468-470[Medline]. |
| 27. |
Smith, J. L.,
E. J. Zaluzec,
J.-P. Wery,
L. Niu,
R. L. Switzer,
H. Zalkin, and Y. Satow.
1994.
Structure of the allosteric regulatory enzyme of purine biosynthesis.
Science
264:1427-1433 |
| 28. |
Souciet, J.-L.,
M. A. Hermodson, and H. Zalkin.
1988.
Mutational analysis of the glutamine phosphoribosylpyrophosphate amidotransferase pro-peptide.
J. Biol. Chem.
263:3323-3327 |
| 29. | Tikkanen, R., A. Riikonen, C. Oinonen, J. Rouvinen, and L. Peltonen. Functional analyses of active site residues of human lysosomal aspartylglucosaminidase: implications for catalytic mechanism and autocatalytic activation. EMBO J. 15:2954-2960. |
| 30. | Zalkin, H., and J. L. Smith. 1998. Enzymes using glutamine as an amide donor. Adv. Enzymol. Relat. Areas Mol. Biol. 72:87-144[Medline]. |
This article has been cited by other articles:
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Copyright © 2009 by the American Society for Microbiology. For an alternate route to Journals.ASM.org, visit: http://intl-journals.asm.org | More Info»