JB
Home Help [Feedback] [For Subscribers] [Archive] [Search] [Contents]
This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrowReprints and Permissions
Right arrow Copyright Information
Right arrow Books from ASM Press
Right arrow MicrobeWorld
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Bock, A.-K.
Right arrow Articles by Schönheit, P.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Bock, A.-K.
Right arrow Articles by Schönheit, P.

 Previous Article  |  Next Article 

Journal of Bacteriology, March 1999, p. 1861-1867, Vol. 181, No. 6
0021-9193/99/$04.00+0
Copyright © 1999, American Society for Microbiology. All rights reserved.

Purification and Characterization of Two Extremely Thermostable Enzymes, Phosphate Acetyltransferase and Acetate Kinase, from the Hyperthermophilic Eubacterium Thermotoga maritima

Anne-Katrin Bock,1 Jürgen Glasemacher,1 Roland Schmidt,2 and Peter Schönheit3,*

Institut für Pflanzenphysiologie und Mikrobiologie, Freie Universität Berlin, D-14195 Berlin,1 Fachbereich Biologie/Chemie, Arbeitsgruppe Mikrobiologie, Universität Osnabrück, D-49069 Osnabrück,2 and Institut für Allgemeine Mikrobiologie, Christian-Albrechts-Universität Kiel, D-24118 Kiel,3 Germany

Received 22 September 1998/Accepted 6 January 1999


    ABSTRACT
Top
Abstract
Introduction
Materials and Methods
Results
Discussion
References

Phosphate acetyltransferase (PTA) and acetate kinase (AK) of the hyperthermophilic eubacterium Thermotoga maritima have been purified 1,500- and 250-fold, respectively, to apparent homogeneity. PTA had an apparent molecular mass of 170 kDa and was composed of one subunit with a molecular mass of 34 kDa, suggesting a homotetramer (alpha 4) structure. The N-terminal amino acid sequence showed significant identity to that of phosphate butyryltransferases from Clostridium acetobutylicum rather than to those of known phosphate acetyltransferases. The kinetic constants of the reversible enzyme reaction (acetyl-CoA + Pi right-left-harpoons  acetyl phosphate + CoA) were determined at the pH optimum of pH 6.5. The apparent Km values for acetyl-CoA, Pi, acetyl phosphate, and coenzyme A (CoA) were 23, 110, 24, and 30 µM, respectively; the apparent Vmax values (at 55°C) were 260 U/mg (acetyl phosphate formation) and 570 U/mg (acetyl-CoA formation). In addition to acetyl-CoA (100%), the enzyme accepted propionyl-CoA (60%) and butyryl-CoA (30%). The enzyme had a temperature optimum at 90°C and was not inactivated by heat upon incubation at 80°C for more than 2 h. AK had an apparent molecular mass of 90 kDa and consisted of one 44-kDa subunit, indicating a homodimer (alpha 2) structure. The N-terminal amino acid sequence showed significant similarity to those of all known acetate kinases from eubacteria as well that of the archaeon Methanosarcina thermophila. The kinetic constants of the reversible enzyme reaction (acetyl phosphate + ADP right-left-harpoons  acetate + ATP) were determined at the pH optimum of pH 7.0. The apparent Km values for acetyl phosphate, ADP, acetate, and ATP were 0.44, 3, 40, and 0.7 mM, respectively; the apparent Vmax values (at 50°C) were 2,600 U/mg (acetate formation) and 1,800 U/mg (acetyl phosphate formation). AK phosphorylated propionate (54%) in addition to acetate (100%) and used GTP (100%), ITP (163%), UTP (56%), and CTP (21%) as phosphoryl donors in addition to ATP (100%). Divalent cations were required for activity, with Mn2+ and Mg2+ being most effective. The enzyme had a temperature optimum at 90°C and was stabilized against heat inactivation by salts. In the presence of (NH4)2SO4 (1 M), which was most effective, the enzyme did not lose activity upon incubation at 100°C for 3 h. The temperature optimum at 90°C and the high thermostability of both PTA and AK are in accordance with their physiological function under hyperthermophilic conditions.


    INTRODUCTION
Top
Abstract
Introduction
Materials and Methods
Results
Discussion
References

Acetate is an important end product of energy-yielding fermentation processes of many anaerobic and facultative procaryotes. Generally acetate is formed from acetyl coenzyme A (acetyl-CoA), a central intermediate of metabolism. The mechanism of conversion of acetyl-CoA to acetate in prokaryotes, which is coupled with ATP formation, has recently been shown to be dependent on the phylogenetic domain to which the organisms belong (33, 34). (i) In all eubacteria analyzed, acetyl-CoA is converted to acetate by the "classical" mechanism involving two enzymes, phosphate acetyltransferase (PTA) (EC 2.3.1.8) and acetate kinase (AK) (EC 2.7.2.1). ATP is formed in the acetate kinase reaction by the mechanism of substrate-level phosphorylation. Acetyl-CoA + Pi right-left-harpoons  acetyl phosphate + CoA (PTA) Acetyl phosphate + ADP right-left-harpoons  acetate + ATP (AK)

(ii) In all acetate forming archaea studied so far, including anaerobic hyperthermophiles and aerobic mesophilic halophiles, the conversion of acetyl-CoA to acetate and the formation of ATP from ADP and phosphate is catalyzed by only one enzyme, an acetyl-CoA synthetase (ADP forming) (33, 34). Acetyl-CoA + ADP + Pi right-left-harpoons acetate + ATP + CoA

This unusual synthetase, which was first discovered in the anaeobic eukaryote Entamoeba histolytica (23, 30), is part of a novel mechanism of acetate formation and energy conservation in prokaryotes.

Acetate also serves as substrate of catabolism and anabolism in several aerobic and anaerobic prokaryotes. The activation of acetate to acetyl-CoA, which is the first step prior to its utilization in metabolism, is catalyzed either by a single enzyme, an AMP-forming acetyl-CoA synthetase (EC 6.2.1.1) (acetate + CoA + ATP right-left-harpoons  acetyl-CoA + AMP + PPi) or by the AK-PTA couple operating in the reverse direction as described above (12, 33, 36, 40). Besides their function in acetate metabolism, PTA and AK play a role, via acetyl phosphate, in various other processes. For example, in Escherichia coli, acetyl phosphate functions as the phosphoryl donor of response regulator proteins of two-component systems, and a function as a global regulatory signal has therefore been proposed (22, 44).

To date, acetate kinases and phosphate acetyltransferases have been purified from various bacteria and from the archaeon Methanosarcina thermophila. However, these enzymes have not yet been isolated and characterized from hyperthermophilic prokaryotes, which are considered to represent the most ancient living organisms (39).

We have recently studied the glucose metabolism of the hyperthermophilic Thermotoga maritima, (Toptimum = 80°C), which belongs to the deepest branches in the phylogenetic tree within the bacterial domain. The organism ferments glucose to acetate, CO2, H2, and various amounts of lactate (15, 35). Glucose degradation to pyruvate proceeds via the classical Embden-Meyerhof pathway, and pyruvate oxidation to acetyl-CoA involves pyruvate:ferredoxin oxidoreductase. The conversion of acetyl-CoA to acetate and ATP is catalyzed by PTA and AK (34, 35), which is the mechanism of acetate formation typical of bacteria (see above).

In this communication we report on the purification and characterization of AK and PTA from the hyperthermophilic eubacterium Thermotoga maritima.


    MATERIALS AND METHODS
Top
Abstract
Introduction
Materials and Methods
Results
Discussion
References

Source of materials. All fast protein liquid chromatography materials and columns were from Pharmacia (Freiburg, Germany). CoA and ATP were from Biomol (Hamburg, Germany). All other enzymes and coenzymes were from Boehringer (Mannheim, Germany). Unless otherwise stated, other chemicals were reagent grade and were obtained from Merck (Darmstadt, Germany). T. maritima Stamm MSB 8 (DSM 3109) was grown in a 100-liter Biostat fermentor on a medium containing starch (5 g/liter) and yeast extract (5 g/liter) as the carbon and energy source.

Purification of PTA. Since the enzyme was not sensitive to oxygen, it was purified under aerobic conditions (at 15°C). Wet cells (30 g) were suspended in 190 ml of 50 mM Tris-HCl (pH 8.0)-5 mM MgCl2. DNase I was added, and the cells were stirred for 10 min at room temperature. The cells were disrupted by sonication for 2 min with a Branson Sonifier in pulse mode (50% pulsing) with a microtip and output control of 3. Cell debris and unbroken cells were removed by centrifugation for 10 min at 48,000 × g and 4°C. The supernatant (184 ml, 4.3 mg of protein/ml), designated cell extract, was centrifuged at 100,000 × g and 4°C for 60 min. The resulting supernatant contained >90% of the PTA activity. The buffer used for all chromatographic steps was 20 mM Tris-HCl (pH 8.0)-2 mM MgCl2. The 100,000 × g supernatant was applied to a DEAE-Sepharose FF column (3.2 by 8 cm). Protein was eluted at a flow rate of 4.3 ml/min with a linear gradient of 0 to 0.4 M NaCl in buffer (400 ml). The fractions containing the highest PTA activity (43 ml, 0.17 to 0.22 M NaCl) were pooled, diluted fivefold with buffer, and applied to a Q-Sepharose HiLoad 16/10 column. Protein was eluted at a flow rate of 2.5 ml/min with a linear gradient from 0 to 0.5 M NaCl in buffer. The fractions containing the highest PTA activity (25 ml, 0.31 to 0.36 M NaCl) were pooled, adjusted to a final concentration of 1 M (NH4)2SO4 by addition of 25 ml of buffer containing 2 M (NH4)2SO4, and applied to a phenyl-Sepharose HiLoad 26/10 column equilibrated with buffer containing 1 M (NH4)2SO4. Protein was desorbed at a flow rate of 8 ml/min with a decreasing gradient from 1 to 0 M (NH4)2SO4 in buffer (300 ml). The fractions with the highest PTA activities were pooled, diluted 40-fold with buffer, and applied to a Resource Q column (6 ml) for concentration of protein. Protein was eluted at a flow rate of 6 ml/min at 0.6 M NaCl in buffer. The protein-containing fractions (2 ml) were applied to a Superdex 200 HiLoad 26/60 column equilibrated with Tris-HCl (pH 8.0)-2 mM MgCl2-0.15 M NaCl. Protein was eluted at a flow rate of 1 ml/min. The PTA-containing fractions were recovered between 150 and 160 ml. The fractions (10 ml) were pooled, diluted threefold with buffer, and applied to a Mono Q column (1 by 10 cm). Protein was eluted at a flow rate of 2 ml/min with a linear gradient of 0 to 0.5 M NaCl in buffer (290 ml). The fractions containing the highest PTA activities (10 ml) were eluted between 0.31 and 0.34 M NaCl.

Purification of AK. The oxygen-insensitive enzyme was purified at 15°C under aerobic conditions. Frozen cells (25 g, wet weight) were suspended in 160 ml of 50 mM Tris-HCl (pH 8.0) containing 5 mM MgCl2 and DNase I. The cells were stirred for 10 min and then disrupted by sonication as described above for PTA. After centrifugation (15 min) at 16,000 × g and 4°C, the resulting supernatant (165 ml, 4.2 mg of protein/ml), designated cell extract, was centrifuged at 100,000 × g and 4°C for 90 min.

The buffer used for all chromatographic steps was 20 mM Tris-HCl (pH 8.0) supplemented with 2 mM MgCl2. The 100,000 × g supernatant was applied to a DEAE-Sepharose FF column (3.2 by 8 cm). Protein was eluted at a flow rate of 4.3 ml/min with a linear gradient from 0 to 0.4 M NaCl in buffer (400 ml). The fractions containing the highest AK activity (32 ml, 0.15 to 0.19 M NaCl) were pooled, diluted fourfold with buffer, and then applied to a Q-Sepharose HiLoad 16/10 column. Protein was eluted at a flow rate of 2.5 ml/min with a linear gradient from 0 to 0.35 M NaCl in buffer (200 ml). The fractions containing the highest AK activity (20 ml, 0.21 to 0.25 M NaCl) were pooled and adjusted to a final concentration of 1 M (NH4)2SO4 by adding 20 ml of buffer containing 2 M (NH4)2SO4 and were subsequently applied to a phenyl-Sepharose HiLoad 26/10 column equilibrated with buffer containing 1 M (NH4)2SO4. Protein was desorbed at a flow rate of 8 ml/min with a decreasing gradient of 1 to 0 M (NH4)2SO4 in buffer (300 ml). The highest AK activity eluted at 0.53 to 0.47 M (NH4)2SO4 (38 ml). The eluate was concentrated to 0.7 ml by ultrafiltration with Centricon 30 microconcentrator (Amicon) (cutoff of 30 kDa) and then applied to a Superdex 200 HiLoad 26/60 column equilibrated with buffer containing 0.15 M NaCl. Protein was eluted at a flow rate of 1 ml/min, and the AK activity was recovered in the fractions between 180 and 195 ml. The fractions were pooled (15 ml), diluted fourfold with buffer, and applied to a Mono Q column (1 by 10 cm). Protein was eluted at a flow rate of 2 ml/min with a linear gradient from 0 to 0.25 M NaCl in buffer (160 ml). The highest AK activity eluted at 0.2 to 0.22 M NaCl (8.8 ml).

PTA activity. PTA activity (which catalyzes the reaction acetyl-CoA + Pi right-left-harpoons  acetyl phosphate + CoA) was measured at 55°C under aerobic conditions by using two different assays. In the first assay, the phosphate-dependent release of CoA from acetyl-CoA was monitored with Ellman's thiol reagent, 5,5'-dithiobis(2-nitrobenzoic acid) (DTNB) (38), by measuring the formation of the thiophenolate anion at 412 nm (varepsilon 412 = 13.5 mM-1 cm-1). The assay mixture (1 ml) contained 100 mM Tris-HCl (pH 7.2), 5 mM MgCl2, 5 mM KH2PO4, 0.1 mM DTNB, and 0.1 mM acetyl-CoA. This assay was used (i) to routinely assay PTA activity during the purification procedure, (ii) to determine the apparent Km values for acetyl-CoA and phosphate as well as the temperature and pH optima of the enzyme, (iii) to test the thermostability of the enzyme between 80 and 100°C, and (iv) to determine the specificity of the enzyme for other CoA esters of organic acids. In the second assay, the formation of acetyl-CoA from acetyl phosphate and CoA was monitored at 233 nm (varepsilon 233 = 4.44 mM-1 cm-1). The assay mixture (1 ml) contained 100 mM Tris-HCl (pH 7.2), 2 mM acetyl phosphate, and 0.15 mM CoA. The assay was used to determine the apparent Km values for acetyl phosphate and CoA.

AK activity. AK activity (which catalyzes the reaction acetyl-P + ADP right-left-harpoons  acetate + ATP) was measured under aerobic conditions by using three different assay systems. In the first assay, the acetate-dependent ADP formation from ATP was assayed at 55°C by coupling the reaction with the oxidation of NADH via pyruvate kinase and lactate dehydrogenase (33). This assay was used (i) to routinely monitor acetate kinase activity during the purification procedure, (ii) to determine apparent Km values for acetate and ATP, and (iii) to test the thermostability of the enzyme between 80 and 100°C. In the second assay, the ATP-dependent acetyl phosphate formation from acetate was assayed at 40 to 110°C by monitoring the formation of acetyl hydroxamate from acetyl phosphate and hydroxylamine at 540 nm (varepsilon 540 = 0.46 mM-1 cm-1) (1)). This assay was used to determine (i) the specificity of the enzyme for organic acids, nucleotides, and divalent cations, (ii) the apparent Km value for Mg2+, and (iii) the temperature and pH optima of the enzyme. In the third assay, the formation of ATP from acetyl phosphate and ADP was monitored at 50°C by coupling the reaction with the reduction of NADP+ via hexokinase and glucose-6-phosphate dehydrogenase (33). This assay was used to determine apparent Km values of acetyl phosphate and ADP.

The pH dependence of both enzymes was measured in 100 mM Tris buffer adjusted with HCl to pH values between 6 and 8. The temperature dependence of the enzymes was measured between 30 and 110°C. The thermostability of the purified enzymes (AK, 0.71 µg in 0.1 ml; PTA, 0.26 µg in 0.1 ml) was tested in sealed vials which were incubated at 80, 90, and 100°C up to 180 min. At various time intervals the vials were cooled on ice and remaining enzyme activity was tested at 55°C. The effects of salts [KCl, NaCl, (NH4)2SO4, and NH4Cl, each at 1 M] on thermostability were tested at 100°C.

Protein and amino acid determination. Protein was quantified by the method of Bradford (6) with bovine serum albumin as the standard, and N-terminal amino acid sequences were determined as described previously (14).


    RESULTS
Top
Abstract
Introduction
Materials and Methods
Results
Discussion
References

Purification and properties of PTA. PTA activity in cell extracts of T. maritima was about 0.13 U/mg (55°C). Almost all activity was retained in the 100,000 × g supernatant, indicating that the enzyme is not an integral membrane protein. The subsequent purification steps involved chromatography on DEAE-Sepharose, Q-Sepharose, phenyl-Sepharose, Superdex 200, and Mono Q. During gel filtration on Superdex 200, significant amounts (>70%) of the enzyme were lost for unknown reasons. After chromatography on Mono Q, the enzyme was apparently homogeneous, since only one band was detected both on denaturing sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) (Fig. 1) and on native PAGE (results not shown). At this stage, the enzyme was purified about 1,500-fold (225 U/mg at 55°C) with a yield of about 2%. Thus, PTA represents about 0.07% of the cellular protein of Thermotoga. The purified enzyme (10 µg/ml) could be stored without significant loss of activity for several weeks at -20°C in buffer (20 mM Tris-HCl [pH 8.0], 2 mM MgCl2, 0.32 M NaCl) supplemented with glycerol (10%, vol/vol).


View larger version (38K):
[in this window]
[in a new window]
 
FIG. 1.   Analysis of PTA from T. maritima by SDS-PAGE at various steps of the purification procedure. Fractions with the highest specific activities obtained after various chromatographic steps (see Materials and Methods) were used. Protein was denatured in SDS and separated in 14% polyacrylamide slab gels (8 by 7 cm) (19), which were stained with Coomassie brilliant blue R 250. Lanes: 1 and 8, molecular mass standards (Sigma); 2, 100,000 × g supernatant, 12 µg of protein; 3, DEAE-Sepharose, 10 µg of protein; 4, Q-Sepharose, 10 µg of protein; 5, phenyl-Sepharose, 8 µg of protein; 6, Superdex 200, 6 µg of protein; 7 Mono Q, 2 µg of protein. The positions of molecular mass standards are indicated on the left.

(i) Molecular and catalytic properties. The apparent molecular mass of native PTA was determined to be about 170 kDa by gel filtration on Superdex 200. SDS-PAGE revealed only one subunit, with an apparent molecular mass of 34 kDa, suggesting that the native enzyme has a homotetrameric (alpha 4) structure. PTA was colorless and exhibited a UV-visible spectrum similar to that of bovine serum albumin, indicating the absence of a chromophoric prosthetic group. The N-terminal amino acid sequence of the 34-kDa subunit (MFLEKLVEMAYGKGKKLAVAAANDDHVIEAVYRAWRERV) showed high homology (39% identity and 49% similarity) to phosphate butyryltransferases from Clostridium acetobutylicum ATCC 824 (43) and NCIMB 8052 (27) rather than to PTAs from other bacteria and the archaeon M. thermophila. The kinetic constants of purified PTA were determined for both directions of the reaction (acetyl-CoA + Pi right-left-harpoons  acetyl phosphate + CoA). The apparent (Km values for acetyl-CoA, Pi, acetyl phosphate, and CoA, obtained from linear Lineweaver-Burk plots, were 23, 110, 235, and 30 µM, respectively; the apparent Vmax values (at 55°C) were 260 U/mg (acetyl phosphate formation) and 570 U/mg (acetyl-CoA formation). The pH optimum for enzyme activity was at pH 6.5; about 80 and 60% of the activity were found at pH 6.0 and 8.0, respectively. In addition to acetyl-CoA (100%), PTA accepted propionyl-CoA (60%) and butyryl-CoA (33%) as substrates. KCl (up to 400 mM) and NaCl (up to 100 mM) did not affect PTA activity, and (NH4)2SO4 (300 mM) inhibited PTA activity by 65%. Both NH4Cl (200 mM), and MgCl2 (50 mM) slightly increased PTA activity to about 140%. KH2PO4 at 20 mM, which inhibits M. thermophila PTA, did not affect T. maritima PTA.

(ii) Temperature optimum and stability. The temperature dependence of PTA is shown in Fig. 2. The enzyme showed little activity at 40°C, and its activity increased rapidly above 55°C. The temperature optimum was at 90°C. From the linear part of the Arrhenius plot between 40 and 80°C, an activation energy of 70.3 kJ/mol was calculated. The temperature stability of the purified enzyme was tested between 80 and 100°C in 20 mM Tris-HCl (pH 8.0)-320 mM NaCl. At 80°C the enzyme did not lose activity after incubation for 2 h; 30% and 60% of the activity were lost after incubation for 2 h at 90 and 100°C, respectively. Various salts [NaH2PO4, KCl, NaCl, NH4Cl, (NH4)2SO4, KH2PO4] at 1 M did not significantly stabilize PTA against heat inactivation.


View larger version (14K):
[in this window]
[in a new window]
 
FIG. 2.   Effect of temperature on the specific activity of PTA from T. maritima. (A) Temperature dependence of the specific activity. (B) Arrhenius plot of the same data. Enzyme activity was measured in the direction of acetyl phosphate formation from acetyl-CoA (see Materials and Methods). The assay mixture contained 0.087 µg of protein. T, temperature.

Purification and properties of AK. AK activity in cell extracts (5.7 U/mg at 55°C), which was not sensitive to oxygen, was purified under aerobic conditions. The purification steps used were the same as described above for the purification of PTA. After the last chromatographic step on Mono Q, the enzyme appeared homogeneous; only one protein band was detected on SDS-PAGE (Fig. 3). At this stage, the enzyme was purified 215-fold (1,185 U/mg at 55°C) with a yield of 9%, indicating that AK represents 0.5% of the cellular T. maritima protein. Purified AK could be stored in 20 mM Tris-HCl (pH 8.0)-2 mM MgCl2-210 mM NaCl at -20°C for several weeks without loss of activity.


View larger version (37K):
[in this window]
[in a new window]
 
FIG. 3.   Analysis of AK from T. maritima by SDS-PAGE at various steps of the purification procedure. Fractions with the highest specific activities obtained after various chromatographic steps (see Materials and Methods) were used. Protein was denatured in SDS and separated in 14% polyacrylamide slab gels (8 by 7 cm) (19), which were stained with Coomassie brilliant blue R 250. Lanes: 1 and 8, molecular mass standards (Sigma); 2, 100,000 × g supernatant, 12 µg of protein; 3, DEAE-Sepharose, 10 µg of protein; 4, Q-Sepharose, 7 µg of protein; 5, phenyl-Sepharose, 5 µg of protein; 6, Superdex 200, 3 µg of protein; 7, Mono Q, 2 µg of protein. The positions of molecular mass standards are indicated on the left.

(i) Molecular and catalytic properties. The apparent molecular mass of native AK, as determined by gel filtration on Superdex 200, was about 90 kDa. SDS-PAGE revealed the presence of only one subunit with apparent molecular mass of 44 kDa, indicating a homodimer (alpha 2) structure. The N-terminal amino acid sequence of the 44-kDa subunit was determined. This sequence, MRVLVINSGSSS, showed high homology to that of all known AK from bacteria and the archaeon M. thermophila. The colorless AK showed UV-visible spectrum similar to that of bovine serum albumin, indicating the absence of a chromophoric prosthetic group. The kinetic constants of purified AK were determined for both directions of the reaction (acetyl phosphate + ADP right-left-harpoons  acetate + ATP). The apparent Km values for acetyl phosphate, ADP, acetate, and ATP, obtained from linear Lineweaver-Burk plots, were 0.44, 3, 40, and 0.7 mM, respectively. The apparent Vmax values were 2,600 U/mg at 50°C (acetate formation) and 1,800 U/mg at 55°C (acetyl phosphate formation). The pH optimum of AK was at pH 7.0. About 50% of the activity was found at pH 6 and 80% at pH 8.5. The enzyme phosphorylated propionate at 54% of the rate for acetate (100%; 530 U/mg at 50°C); butyrate, isobutyrate, valerate, and isovalerate, were not accepted. Besides ATP (100%; 580 U/mg at 50°C), the purine nucleotides GTP (100%) and ITP (163%) and the pyrimidine nucleotides UTP (56%) and CTP (21%) served as phosphoryl donors for acetate phosphorylation. The reaction was dependent on divalent cations. Mn2+ (180%) and Mg2+ (100%; 1,300 U/mg) were the most effective and could partially be replaced by Co2+ (30%), Zn2+ (15%), and Ca2+ (12%) in preference to Ni2+ (4%) and Cu2+ (<4%). AK activity was monitored by increasing the MgCl2 concentrations at a constant ATP concentration of 10 mM. The highest activities were found at 10 mM MgCl2, indicating an optimal Mg2+/ATP ratio of 1:1.

(ii) Temperature optimum and thermostability. The temperature dependence of AK activity, measured between 30 and 110°C, showed an optimum at 90°C. From the linear part of the Arrhenius plot between 55 and 90°C, an activation energy of 21 kJ/mol was calculated. The thermostability of AK was tested between 80 and 100°C in 20 mM Tris-HCl (pH 8.0)-150 mM NaCl. At 80°C, AK did not lose activity upon incubation for 180 min. At 90°C, 30% of the activity was lost after 180 min and an almost complete loss (>90%) was observed after incubation at 100°C for about 60 min. The various salts [NaCl, KCl, (NH4)Cl, and (NH4)2SO4)] were tested at 1 M for their ability to protect AK against heat inactivation at 100°C. In the presence of (NH4)2SO4, which was the most effective, the enzyme did not lose activity for 180 min. KCl and NaCl also stabilized enzyme activity for about 60 min. A further increase of incubation time to 180 min resulted in loss of 75% of the activity (Fig. 4). NH4Cl had no effect on thermostability.


View larger version (22K):
[in this window]
[in a new window]
 
FIG. 4.   Effect of various salts on the thermostability of AK from T. maritima at 100°C. The 0.1-ml incubation mixtures contained 20 mM Tris-HCl (pH 8.0), 150 mM NaCl, and 0.36 µg of enzyme. Salts (1 M) were included as indicated. At the times indicated, the remaining enzyme activity was measured at 55°C in the direction of acetyl phosphate formation (pyruvate kinase/lactate dehydrogenase assay).


    DISCUSSION
Top
Abstract
Introduction
Materials and Methods
Results
Discussion
References

In this communication we reported the purification and properties of PTA and AK from the hyperthermophilic eubacterium T. maritima. This is the first report on the characterisation of these "classical" acetate-forming enzymes from a hyperthermophilic ancestral organism.

PTA of T. maritima had a native molecular mass of about 170 kDa and was composed of a single subunit of about 35 kDa, suggesting a homotetrameric structure. PTAs had been isolated from various eubacteria and the archaeon M. thermophila; their molecular properties and kinetic constants are given in Table 1. All PTAs that have been analyzed for this property, consist of a single subunit with relative molecular masses ranging from 20 kDa (C. thermoaceticum) to 80 kDa (E. coli). Comparison with molecular masses of the native enzymes indicate monomeric, dimeric, and tetrameric structures. Like the PTA from Clostridium thermoaceticum, the Thermotoga enzyme is apparently homotetrameric, but it has twice the molecular mass of subunits and native enzyme.

                              
View this table:
[in this window]
[in a new window]
 
TABLE 1.   Molecular and kinetic properties of purified PTA from eubacteria and M. thermophila

PTA from Thermotoga exhibits the lowest apparent Km values of all substrates (Table 1) and one of the highest Vmax values (approximately 1,000 to 2,000 U/mg at 90°C, taking into account the temperature dependence of enzyme activity). Like the PTA from other organisms (e.g., from Bacillus subtilis, Clostridium kluyveri, and Rhodopseudomonas palustris), the Thermotoga enzyme used propionyl-CoA (60%) and butyryl-CoA (30%) as substrates in addition to acetyl-CoA (100%). In contrast to PTAs from bacteria and from the archaeon M. thermophila, which are stimulated by KCl and inhibited by NaCl, these salts did not affect PTA from Thermotoga (for a comparison of specific activities and of metal effects of various PTAs, see reference 21).

The N-terminal amino acid sequence of Thermotoga PTA shows a higher homology to the corresponding sequences of phosphate butyryltransferases from Clostridium acetobutylicum. However, alignments of complete amino acid sequences of PTAs from Escherichia coli, Clostridium acetobutylicum, Bacillus subtilis, Paracoccus denitrificans, Methanosarcina thermophila, Mycoplasma genitalium, and Mycoplasma capricolum as deduced from available gene (pta) sequences in databases (5, 47) showed that they had a high overall homology to each other, ranging from 40 to 60% identity and 60 to 70% similarity. A phylogenetic tree of sequenced PTAs is given by Zhu et al. (47) and Rasche et al. (29). Since all amino acid sequences exhibited a rather poor N-terminal homology (5), only the comparison of the overall amino acid sequence of Thermotoga PTA will give conclusive information about homology to other PTAs. This will have to await the completion of the entire sequence of the PTA gene of thermophile. Sequencing of the complete T. maritima genome is in progress.

PTA from T. maritima showed the highest temperatur optimum (about 90°C) and the highest thermostability of all PTAs analyzed. The enzyme did not lose activity upon incubation for 2 h at 80°C and lost only 30% of its activity upon incubation at 90°C (2 h). For comparison, PTA from the moderate thermophile M. thermophila had a temperature optimum at about 40°C and was completely inactivated after incubation for 5 min at 80°C (21). PTA from Clostridium thermoaceticum showed a temperature optimum of 75°C (11).

AK of T. maritima had a native molecular mass of 90 kDa and was composed of a single subunit of 44 kDa, indicating a homodimeric structure. As shown in Table 2, a homodimeric structure is typical of most AKs from eubacteria and the archaeon M. thermophila. Exceptions are the AKs of Clostridium thermoaceticum and of Bacillus stearothermophilus, which have been reported to be monomeric and homotetrameric enzymes, respectively. Furthermore, comparison of the N-terminal amino acid sequence of Thermotoga AK (MRVLVIN S GSSS) revealed a high degree of homology to AK from eubacteria and the archaeon M. thermophila, with the underlined amino acids being almost completely conserved (>80% identity within the first 15 N-terminal amino acids). Alignments of N-terminal and complete amino acid sequences of AKs, including those of, e.g., Bacillus subtilis, Escherichia coli, Mycoplasma capricolum, Mycoplasma genitalum, Clostridium acetobutylicum, Haemophilus influenzae, and M. thermophila, are given in references 5, 9, and 47 (for a phylogenetic tree of sequenced AKs, see reference 47).

                              
View this table:
[in this window]
[in a new window]
 
TABLE 2.   Molecular and kinetic properties of purified AK from eubacteria and M. thermophila

The kinetic properties of Thermotoga AK were very similar to the enzymes of eubacteria and the archaeon M. thermophila. As shown in Table 2, the apparent Km values for substrates vary somewhat but all AKs have high values for acetate independent of whether the enzymes catalyze the activation (as, e.g., in M. thermophila) or the production of acetate in the metabolism. The Thermotoga enzyme showed a very high specific activity up to about 6,000 U/mg at 90°C (2,600 U/mg at 50°C), taking into account the temperature dependence of the enzyme.

Like all known AKs, the Thermotoga enzyme requires divalent cations for activity; Mg2+ and Mn2+ are the most effective. The enzyme has an optimal Mg2+/ATP ratio of 1:1, suggesting that Mg2+ is required only to complex ATP rather than to have additional effects on enzyme function or stability. A 1:1 ratio has also been determined for the enzymes of Escherichia coli, Salmonella typhimurium, and M. thermophila (1, 13). For AK from C. acetobutylicum, an optimal Mg2+/ATP ratio of 2 has been reported (10). Furthermore, the substrate specificities of AK with respect to the acids other than acetate and nucleotides other than ATP were similar to those of most AKs; for example, like the AK from M. thermophila (1), the Thermotoga enzyme phosphorylated propionate (54%) in addition to acetate (100%) and used various purine and pyrimidine nucleotides (GTP, ITP, UTP, CTP) effectively as phosphoryl donors for acetate phosphorylation.

AK showed a temperature optimum at 90°C, which is the highest value of all AKs analyzed. Furthermore, the enzyme exhibited an extreme thermostability, which was increased by the addition of salts. In the presence 1 M (NH4)2SO4, the enzyme did not lose activity upon incubation for 180 min at 100°C. AK from the moderate thermophile M. thermophila was almost completely inactivated after a 15-min incubation at 75°C. An increase of thermostability by salts has also been demonstrated for other enzymes from hyperthermophiles, e.g., Pyrococcus furiosus, Methanopyrus kandleri, and Archaeoglobus fulgidus (7, 14, 17; for reviews, see references 2 and 20).

In summary, both PTA and AK of the hyperthermophile T. maritima showed similar molecular and catalytic properties to those of their mesophilic and moderately thermophilic counterparts. They differ, however, in their extremely high temperature optimum and their high thermostability, which is in accordance with the hyperthermophilic nature of Thermotoga. In this respect, both PTA and AK may serve as model enzymes for analyses of the reasons for the thermostability of proteins in general. Cloning of the genes encoding both AK and PTA from Thermotoga and their expression in E. coli is in progress with the aim of crystallizing the proteins. So far, crystallization of the AK from M. thermophila and a prediction of its folding have been reported (9).


    ACKNOWLEDGMENTS

This work was supported by grants from the European Union (Biotechnology of Extremophiles) and the Fonds der Chemischen Industrie.


    FOOTNOTES

* Corresponding author. Mailing address: Institut für Allgemeine Mikrobiologie, Christian-Albrechts-Universität Kiel, Am Botanischen Garten 1-9, D-24118 Kiel, Germany. Phone: 49-431-880-4328. Fax: 49-431-880-2194. E-mail: peter.schoenheit{at}ifam.uni-kiel.de.


    REFERENCES
Top
Abstract
Introduction
Materials and Methods
Results
Discussion
References

1. Aceti, D. J., and J. G. Ferry. 1988. Purification and characterization of acetate kinase from acetate-grown Methanosarcina thermophila. Evidence for regulation of synthesis. J. Biol. Chem. 263:15444-15448[Abstract/Free Full Text].
2. Adams, M. W. W. (ed.). 1996. Enzymes and proteins from hyperthermophilic microorganisms. Adv. Protein Chem. 48:1-509[Medline].
3. Bergmeyer, H. U., G. Holz, H. Klotzsch, and G. Lang. 1963. Phosphotransacetylase aus Clostridium kluyveri. Züchtung des Bacteriums, Isolierung, Kristallisation und Eigenschaften des Enzymes. Biochem. Z. 338:114-121[Medline].
4. Bowmann, C. M., R. O. Valdez, and J. S. Nishimura. 1976. Acetate kinase from Veillonella alcalescens. Regulations of enzyme activity by succinate and substrates. J. Biol. Chem. 251:3117-3121[Abstract/Free Full Text].
5. Boynton, Z. L., G. N. Benett, and F. B. Rudolph. 1996. Cloning, sequencing, and expression of genes encoding phosphotransacetylase and acetate kinase from Clostridium acetobutylicum ATCC 824. Appl. Environ. Microbiol. 62:2758-2766[Abstract].
6. Bradford, M. M. 1976. A rapid and sensitive method for the quantitation of microgram quantities of protein utilizing the principle of protein-dye binding. Anal. Biochem. 72:248-254[Medline].
7. Breitung, J., R. A. Schmitz, K. O. Stetter, and R. K. Thauer. 1991. N5, N10, -Methenyltetrahydromethanopterin cyclohydrolase from the extreme thermophile Methanopyrus kandleri: increase of catalytical efficiency (Kcat/Km) and thermostability in the presence of salts. Arch. Microbiol. 156:517-524.
8. Brown, T. D. K., M. C. Jones-Mortimer, and H. L. Kornberg. 1977. The enzymic interconversion of acetate and acetyl-coenzyme A in Escherichia coli. J. Gen. Microbiol. 102:327-336[Medline].
9. Buss, K. A., C. Ingram-Smith, J. G. Ferry, D. A. Sanders, and M. S. Hasson. 1997. Crystallization of acetate kinase from Methanosarcina thermophila and prediction of its fold. Protein Sci. 6:2659-2662[Abstract].
10. Diez-Gonzales, F., J. B. Russell, and J. B. Hunter. 1997. The acetate kinase of Clostridium acetobutylicum strain P262. Arch. Microbiol. 166:418-420.
11. Drake, H. L., S. I. Hu, and H. G. Wood. 1981. Purification of five components from Clostridium thermoaceticum with catalyze synthesis of acetate from pyruvate and methyltetrahydrofolate. J. Biol. Chem. 256:11137-11144[Abstract/Free Full Text].
12. Ferry, J. G. 1997. Enzymology of the fermentation of acetate to methane by Methanosarcina thermophila. Biofactors 6:25-35[Medline].
13. Fox, D. K., and S. Roseman. 1986. Isolation and characterization of homogeneous acetate kinase from Salmonella typhimurium and Escherichia coli. J. Biol. Chem. 261:13487-13497[Abstract/Free Full Text].
14. Glasemacher, J., A.-K. Bock, R. Schmidt, and P. Schönheit. 1997. Purification and properties of acetyl-CoA synthetase (ADP-forming), an archaeal enzyme of acetate formation and ATP synthesis from the hyperthermophile Pyrococcus furiosus. Eur. J. Biochem. 244:561-567[Medline].
15. Huber, R., T. A. Langworthy, H. König, M. Thomm, C. R. Woese, U. B. Sleytr, and K. O. Stetter. 1986. Thermotoga maritima sp. nov. represents a new genus of unique extremely thermophilic eubacteria growing up to 90°C. Arch. Microbiol. 144:324-333.
16. Kahane, I., and A. Muhlrad. 1979. Purification and properties of acetate kinase from Acholeplasma laidlawii. J. Bacteriol. 137:764-772[Abstract/Free Full Text].
17. Kunow, J., D. Linder, and R. K. Thauer. 1995. Pyruvate:ferredoxin oxidoreductase from the sulfate reducing Archaeoglobus fulgidus: molecular composition, catalytical properties, and sequence alignments. Arch. Microbiol. 163:21-28[Medline].
18. Kryptopoulos, S. A., and D. P. N. Satchell. 1973. Kinetic studies with phosphotransacetylase. V. The mechanism of activation by univalent cations. Biochim. Biophys. Acta 321:126-142[Medline].
19. Laemmli, U. K. 1970. Cleavage of structural proteins during the assembly of the head of bacteriophage T4. Nature 227:680-685[Medline].
20. Leuschner, C., and G. Antranikian. 1995. Heat stable enzymes from extremely thermophilic and hyperthermophilic microorganisms. World J. Microbiol. Biotechnol. 11:95-114.
21. Lundie, L. L., Jr., and J. G. Ferry. 1989. Activation of acetate by Methanosarcina thermophila. Purification and characterization of phosphotransacetylase. J. Biol. Chem. 264:18392-18396[Abstract/Free Full Text].
22. McClearly, W. R., J. B. Stock, and A. J. Ninfa. 1993. Is acetyl phosphate a global signal in Escherichia coli? J. Bacteriol. 175:2793-2798[Free Full Text].
23. Müller, M. 1988. Energy metabolism without mitochondria. Annu. Rev. Microbiol. 42:465-488[Medline].
24. Nakijima, H., K. Suzuki, and K. Imahori. 1978. Purification and properties of acetate kinase from Bacillus stearothermophilus. J. Biochem. 84:193-203[Abstract/Free Full Text].
25. Nishimura, J. S., and M. J. Griffith. 1981. Acetate kinase from Veillonella alcalescens. Methods Enzymol. 71:311-316.
26. Nojiri, T., F. Tanaka, and I. Nakayama. 1971. Purification and properties of phosphotransacetylase from Lactobacillus fermenti. J. Biochem. 69:789-801[Abstract/Free Full Text].
27. Oultram, J. D., I. D. Burr, M. J. Elmore, and N. P. Minton. 1993. Cloning and sequence analysis of the genes encoding phosphotransbutyrylase and butyrate kinase from Clostridium acetobutylicum NCIMB 8052. Gene 131:107-112[Medline].
28. Rado, T. A., and J. A. Hoch. 1973. Phosphotransacetylase from Bacillus subtilis: purification and physiological studies. Biochim. Biophys. Acta 321:114-125[Medline].
29. Rasche, M. E., K. S. Smith, and J. G. Ferry. 1997. Identification of cysteine and arginine residues essential for phosphotransacetylase from Methanosarcina thermophila. J. Bacteriol. 179:7712-7717[Abstract/Free Full Text].
30. Reeves, R. E., L. G. Warren, B. Susskind, and H. S. Lo. 1977. An energy-conserving pyruvate-to-acetate pathway in Entamoeba histolytica: pyruvate synthase and a new acetate thiokinase. J. Biol. Chem. 252:726-731[Abstract/Free Full Text].
31. Robinson, J. R., and R. D. Sagers. 1972. Phosphotransacetylase from Clostridium acidiurici. J. Bacteriol. 112:465-473[Abstract/Free Full Text].
32. Schaupp, A., and L. G. Ljungdahl. 1974. Purification and properties of acetate kinase from Clostridium thermoaceticum. Arch. Microbiol. 100:121-129[Medline].
33. Schäfer, T., M. Selig, and P. Schönheit. 1993. Acetyl-CoA synthetase (ADP-forming) in archaea, a novel enzyme involved in acetate formation and ATP synthesis. Arch. Microbiol. 159:72-83.
34. Schönheit, P., and T. Schäfer. 1995. Metabolism of hyperthermophiles. World J. Microbiol. Biotechnol. 11:26-57.
35. Schröder, C., M. Selig, and P. Schönheit. 1994. Glucose fermentation to acetate, CO2 and H2 in the anaerobic hyperthermophilic eubacterium Thermotoga maritima: involvement of the Embden-Meyerhof pathway. Arch. Microbiol. 161:460-470.
36. Shieh, J., and W. B. Whitman. 1987. Pathway of acetate assimilation in autotrophic and heterotrophic methanococci. J. Bacteriol. 169:5327-5329[Abstract/Free Full Text].
37. Shimizu, M., T. Suzuki, K.-Y. Kameda, and Y. Abiko. 1969. Phosphotransacetylase of Escherichia coli B, purification and properties. Biochim. Biophys. Acta 191:550-558[Medline].
38. Srere, P. A., H. Brazil, and L. Gonen. 1963. The citrate condensing enzyme of pigeon breast muscle and moth flight muscle. Acta Chem. Scand. 17:129-134.
39. Stetter, K. O. 1996. Hyperthermophilic procaryotes. FEMS Microbiol. Rev. 18:149-158.
40. Thauer, R. K., D. Möller-Zinkhan, and A. Spormann. 1989. Biochemistry of acetate catabolism in anaerobic chemotrophic bacteria. Annu. Rev. Microbiol. 43:43-67[Medline].
41. Vigenschow, H., H.-M. Schwarm, and K. Knobloch. 1986. Purification and properties of an acetate kinase from Rhodopseudomonas palustris. Biol. Chem. Hoppe-Seyler 367:951-956[Medline].
42. Vigenschow, H., H.-M. Schwarm, and K. Knobloch. 1986. Purification and properties of a phosphotransacetylase from Rhodopseudomonas palustris. Biol. Chem. Hoppe-Seyler 367:957-962[Medline].
43. Walter, K. A., R. V. Nair, J. W. Cary, G. N. Bennet, and E. T. Papoutsakis. 1994. Sequence and arrangement of two genes of the butyrate-synthesis pathway of Clostridium acetobutylicum ATCC 824. Gene 134:101-111.
44. Wanner, B. L., and M. R. Wilmes-Riesenberg. 1992. Involvement of phosphotransacetylase, acetate kinase, and acetyl phosphate synthesis in control of the phosphate regulon in Escherichia coli. J. Bacteriol. 174:2124-2130[Abstract/Free Full Text].
45. Whiteley, H. R., and R. A. Pelroy. 1972. Purification and properties of phosphotransacetylase from Veillonella alcalescens. J. Biol. Chem. 247:1911-1917[Abstract/Free Full Text].
46. Yamamoto-Otake, H., A. Matsuyama, and E. Nakano. 1990. Cloning of a gene coding for phosphotransacetylase from Escherichia coli. Appl. Microbiol. Biotechnol. 33:680-682[Medline].
47. Zhu, P.-P., and A. Peterkofsky. 1996. Sequence and organization of genes encoding enzymes involved in pyruvate metabolism in Mycoplasma capricolum. Protein Sci. 5:1719-1736[Abstract].


Journal of Bacteriology, March 1999, p. 1861-1867, Vol. 181, No. 6
0021-9193/99/$04.00+0
Copyright © 1999, American Society for Microbiology. All rights reserved.



This article has been cited by other articles:


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrowReprints and Permissions
Right arrow Copyright Information
Right arrow Books from ASM Press
Right arrow MicrobeWorld
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Bock, A.-K.
Right arrow Articles by Schönheit, P.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Bock, A.-K.
Right arrow Articles by Schönheit, P.


Home Help [Feedback] [For Subscribers] [Archive] [Search] [Contents]
Appl. Environ. Microbiol. Infect. Immun. Eukaryot. Cell
Mol. Cell. Biol. J. Virol. Microbiol. Mol. Biol. Rev.
ALL ASM JOURNALS