Previous Article | Next Article 
Journal of Bacteriology, February 2000, p. 944-948, Vol. 182, No. 4
0021-9193/00/$04.00+0
Copyright © 2000, American Society for Microbiology. All rights reserved.
A Novel Operon Encoding Formaldehyde Fixation: the Ribulose
Monophosphate Pathway in the Gram-Positive Facultative Methylotrophic
Bacterium Mycobacterium gastri MB19
Ryoji
Mitsui,1
Yasuyoshi
Sakai,1
Hisashi
Yasueda,2 and
Nobuo
Kato1,*
Division of Applied Life Sciences, Graduate
School of Agriculture, Kyoto University, Kitashirakawa Sakyo-ku,
Kyoto 606-8502,1 and Fermentation
and Biotechnology Laboratories, Ajinomoto Co., Inc., Kawasaki
210-0801,2 Japan
Received 2 August 1999/Accepted 19 November 1999
 |
ABSTRACT |
A 4.2-kb PstI fragment harboring the gene cluster of
the ribulose monophosphate (RuMP) pathway for formaldehyde fixation was identified in the chromosome of a gram-positive, facultative
methylotroph, Mycobacterium gastri MB19, by using the
coding region of 3-hexulose-6-phosphate synthase (HPS) as the
hybridization probe. The PstI fragment contained three
complete open reading frames (ORFs) which encoded from the 5' end, a
DNA-binding regulatory protein (rmpR),
6-phospho-3-hexuloisomerase (PHI; rmpB), and HPS
(rmpA). Sequence analysis suggested that rmpA
and rmpB constitute an operon, and Northern blot analysis of RNA extracted from bacteria grown under various conditions suggested
that the expression of the two genes is similarly regulated at the
transcriptional level. A similarity search revealed that the proteins
encoded by rmpA and rmpB in M. gastri MB19 show high similarity to the unidentified proteins of
nonmethylotrophic prokaryotes, including bacteria and anaerobic
archaea. The clusters in the phylogenetic tree of the HPS protein of
M. gastri MB19 and those in the phylogenetic tree of the
PHI protein were nearly identical, which implies that these two
formaldehyde-fixing genes evolved as a pair. These findings give new
insight into the acquisition of the formaldehyde fixation pathway
during the evolution of diverse microorganisms.
 |
INTRODUCTION |
Many C1 compounds,
including formaldehyde, methane, and formic acid, were present in the
interstellar dust clouds of the primitive earth and were important
precursors of more complex organic compounds. Among them, formaldehyde
is the key intermediate for biological fixation of C1 compounds.
The ribulose monophosphate (RuMP) pathway of formaldehyde fixation
exists in a wide range of methylotrophic bacteria that can grow on
C1 compounds (14). The RuMP pathway can be
divided into three phases. The first, the fixation phase, involves two reactions that are unique to the RuMP pathway: the condensation of
formaldehyde with ribulose 5-phosphate and the subsequent isomerization of the product, D-arabino-3-hexulose
6-phosphate, to yield fructose 6-phosphate. These reactions are
catalyzed by 3-hexulose-6-phosphate synthase (HPS) and
6-phospho-3-hexuloisomerase (PHI), respectively. The second phase
involves cleavage of the hexose phosphate to form two triose
phosphates; glyceraldehyde 3-phosphate (GAP) enters the third phase of
formaldehyde fixation, which consists of rearrangement reactions, while
dihydroxyacetone phosphate (DHAP) enters the central pathway for
synthesis of cell constituents. The third, the rearrangement phase,
contains the reactions that are necessary to regenerate the acceptor of
formaldehyde fixation, ribulose 5-phosphate.
The lack of genetic studies on the RuMP pathway had prevented further
insights into the physiological and evolutionary aspects of this
pathway. We recently reported the gene cluster of the RuMP pathway of a
methylotrophic bacterium, Methylomonas aminofaciens 77a
(16). The rmpA and rmpB genes which
encode HPS and PHI, respectively, are adjacent to rmpI which
encodes IS10-R, whose promoter regions are involved in
regulating the expression of rmpA and rmpB. The
existence of IS10-R suggested that the RuMP pathway gene
cluster was transposed during the evolution of methylotrophs. From this
observation, the question has been raised as to whether such gene
organization of the RuMP pathway is a common feature in other
methylotrophic bacteria.
In this study, we cloned a DNA fragment that harbored the genes
encoding HPS and PHI from the chromosomal DNA of another type of
methanol-utilizing bacterium, a gram-positive and facultative methylotroph, Mycobacterium gastri MB19. We found that the
genes that encode HPS and PHI in M. gastri MB19 constitute a
formaldehyde-fixing operon and that the expression of these two genes
is regulated in a parallel manner. Furthermore, a similarity search
revealed that the chromosome of some nonmethylotrophic bacteria and
archaea contains a pair of genes homologous to rmpA and
rmpB, a finding which suggests that the formaldehyde
fixation pathway is an evolutionary link between bacteria and archaea.
 |
MATERIALS AND METHODS |
Strains and culture conditions.
M. gastri MB19
was grown on the methanol medium described by Kato et al.
(8). Escherichia coli JM109 (18),
which was used as the host for plasmid propagation, was grown in
Luria-Bertani (LB) broth which contained 1% Bacto Tryptone (Difco
Laboratories, Detroit, Mich.), 0.5% Bacto Yeast Extract (Difco
Laboratories), 1% NaCl (pH 7.0), and ampicillin (50 µg/ml); when
necessary, 0.1 mM IPTG
(isopropyl-
-D-thiogalactopyranoside) and 0.05 mM X-Gal (5-bromo-4-chloro-3-indolyl-
-D-galactopyranoside) were
added to the medium.
Analysis of HPS and PHI.
The level of HPS activity and the
PHI activity were assayed according to the methods of Arfman et al.
(2). The amount of protein was determined by using a Bio-Rad
protein assay kit (Japan Bio-Rad Laboratories, Tokyo, Japan) with
bovine serum albumin as the standard. Sodium dodecyl
sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) was performed on
a 15% polyacrylamide gel (10). The apparent molecular mass
of the native enzyme was determined by gel filtration with a fast
protein liquid chromatography system on a Superdex 200 column
(Pharmacia Biotech, Uppsala, Sweden) (15).
HPS was purified from M. gastri MB19 as described by Kato
(7). The N-terminal and several internal amino acid
sequences of the purified HPS were determined as previously described
(21). The N-terminal amino acid sequence (N-1) was
MKYLQVAIDLLSTEAALELAGKVAEYVDIIELGTPLIKA, and the sequences
of several internal peptide fragments were as follows: I-1,
HAGLDEQAK; I-4, ATRAQEVRALGAK; I-5,
VATIPAVQK; I-6, FVEMHAGLDEQAE; I-7,
ARVPFSVAGGVK; I-8, IVFADMK; I-9,
TMDAGELEADIAFK; and I-11, VAEYVDIIELGTPLIK.
Selection of a DNA fragment containing the HPS gene.
A DNA
fragment containing the HPS gene (rmpA) was amplified by PCR
from the chromosomal DNA of M. gastri MB19 by using the following procedure. Upstream and downstream primers were designed based on a part of the sequence of the N terminus (MKLQVAID)
and a part of an internal amino acid sequence (I-6;
FVEMHAGL) of HPS, respectively. The nucleotide sequences of the
primers were as follows: N-terminal (N-1),
5'-ATGAAA(G)C(T)TICAA(G)GTC(A/G/T)GCIATC(A/T)GA-3', and
internal (I-6),
5'-CCC(A/G/T)GCA(G)TGCATC(T)TCC(A/G/T)ACA(G)AA-3'. Chromosomal
DNA was extracted from M. gastri MB19 by using the method of
Marmur (11) and was used as a template for PCR
amplification. The reaction mixture and conditions for PCR were those
for the standard procedure suggested by Perkin-Elmer/Cetus (Takara
Shuzo Co., Kyoto, Japan). The PCR product was electrophoresed on a
2.0% low-melting-temperature agarose gel. The primary band was
extracted from the gel with SUPREC-01 (Takara Shuzo) and then ligated
into pT7Blue vector (Novagen, Madison, Wis.). This PCR product was used
as the rmpA probe.
The chromosomal DNA of M. gastri MB19 was digested with
various restriction enzymes. The digests were electrophoresed on a 0.7% agarose gel in TAE buffer (18) and then transferred
onto a Biodyne nylon membrane (Pall Bio Support Corp., New York, N.Y.). Hybridization was performed with the random primed
32P-labeled rmpA probe under the highly
stringent conditions as recommended by Southern (19). On the
basis of the results of Southern analysis, a PstI-digested
genome library of M. gastri MB19 genomic DNA was
constructed, and the PstI fragment harboring the
rmpA gene was ligated into pUC118 at the PstI.
Colonies of E. coli transformants were transferred to the
Biodyne nylon membrane and lysed with alkaline treatment. The liberated DNA was fixed on the membrane, and hybridization was carried out at
42°C with the 32P-labeled rmpA probe.
Restriction analysis suggested that all of the positive clones had an
identical insert in pUC118, and the recombinant plasmid was designated
pUHM-1.
Nucleotide sequencing.
Several deletion DNA templates of the
PstI fragment containing the HPS gene were prepared for
sequencing with a deletion kit (Takara Shuzo). DNA sequencing of the
deletion DNA templates was performed by the dideoxy chain termination
method by using a PE Applied Biosystems Model 373A Automated DNA
Sequencer (Tokyo, Japan). Sequencing was performed according to the
manual of the ABI Dye Terminator Cycle Sequencing Kit (Perkin-Elmer,
Foster City, Calif.). The National Center for Biotechnology Information database was searched for homologous amino acid sequences with the
BLAST and FASTA programs.
Expression of rmpA and rmpB in E. coli.
The coding region of rmpA and that of
rmpB were each amplified by PCR by using pUHM-1 as the
template. The upstream and downstream primers for amplification of
rmpA were designed from the obtained sequence of the
PstI fragment:
5'-AGAAATCGATAAATGAAGCTCCAAGTCGCCATCG-3' (the translation start codon is underlined) at the N terminal and
5'-AATTCCAGCTCTAGACAAGGCGGTACGGCG-3' at the C
terminal. For PCR amplification of rmpB, the following
primer pair was used: N terminal,
5'-CGAAATCGATAAAAATGACGCAAGCCGCAGAAGCCGACGGCG-3', and C terminal,
5'-TGGGTCTAGAATGTGAAGTAAGAGTTGGTCGTACGAGGTCCG-3'. The reaction mixture and conditions of PCR were as mentioned above. Each PCR product contained the open reading frame (ORF) of
rmpA or rmpB, and the upstream and downstream
ends of the PCR products of both rmpA and rmpB,
and the upstream and downstream ends of the PCR products of both
rmpA and rmpB contained the ClaI and XbaI sites (italicized sequence in the primer),
respectively. The PCR product of rmpA and that of
rmpB were each purified and cloned into the
ClaI/XbaI site of pT13sNco (22), and
the resultant plasmid was designated pT-rmpA or pT-rmpB, respectively.
A pBR322-derived vector, pTTNco (22), was used as the
control plasmid. E. coli JM109 was transformed with one of
the three plasmids. The transformant E. coli strains were
grown on a M9 Casamino Acids medium containing 1 µg of thiamine-HCl
and 100 µg of ampicillin per ml as described by Sambrook et al.
(18) at 37°C for 12 h. The E. coli cells were then washed with 50 mM potassium phosphate buffer (pH 7.6), suspended in the same buffer, and sonicated (150 W, 10 min). The cell
extract was used for measurement of the level of HPS and PHI activity
and for SDS-PAGE.
Northern blot analysis.
M. gastri MB19 was
cultured at 28°C on a minimal salts medium (8) that
contained 1.0% (vol/vol) methanol, ethanol, or glucose as a carbon
source and 0.4% (wt/vol) (NH4)2SO4
or methylamine as a nitrogen source until the middle log phase. The
M. gastri MB19 cells were then harvested by centrifugation
at 6,700 × g for 20 min at 4°C. Some samples were
used for the determination of the level of HPS activity and PHI
activity. Total RNA was extracted from other samples by the
acid-guanidinium thiocyanate-phenol-chloroform method using ISOGEN
(Nippon Gene Co., Ltd., Tokyo, Japan). Northern blot analysis was
performed as described previously (16). Briefly, RNA samples
(20 µg/lane) were electrophoresed on a 1.0% agarose gel containing
20 mM MOPS (morpholine propane sulfonic acid) buffer, 1 mM EDTA, and
2.2 M formaldehyde. Perfect RNA Markers, 0.2 to 10 kb (Novagen,
Madison, Wis.), was used for the nucleotide size measurement. After
electrophoresis, capillary transfer to a nylon membrane (GeneScreen
Plus; NEN Life Science Products, Boston, Mass.) in 20× SSC (1× SSC is
0.15 M NaCl plus 0.015 M sodium citrate) was performed.
Prehybridization and hybridization were carried out at 42°C in a
solution containing 30% formamide, 5× SSC, 0.1% SDS, and 100 µg of
calf thymus DNA per ml, as previously described (17). The
DNA probe consisted of the entire coding region of rmpA or
rmpB and was labeled with a Random Primed DNA Labeling Kit
(Roche Diagnostics K.K., Mannheim, Germany).
Nucleotide sequence accession number.
The sequence reported
in this paper has been deposited in the GenBank-DDBJ database
(accession no. AB034913).
 |
RESULTS |
Nucleotide sequence and structural analysis of pUHM-1.
Determination of the entire nucleotide sequence of the 4.2-kb
PstI insert in pUHM-1 revealed three complete and two
partial ORFs; from the 5' end, they are orf1,
rmpR, rmpB, rmpA, and rmpC. Figure 1A shows the gene diagram of the
insert, which includes some important elements between the ORFs.
rmpA consists of 624 bp, and the deduced amino acid sequence
includes 209 amino acid residues with a theoretical molecular mass of
20,953 Da. This value is close to the molecular mass of the purified
HPS from M. gastri MB19, as determined by SDS-PAGE, of 24 kDa. The N-terminal and internal amino acid sequences of the purified
HPS were found in the deduced amino acid sequence. From this and the
results of the gene expression studies, we concluded that this ORF
encodes the HPS gene. rmpB is located upstream of
rmpA and encodes a protein of 223 amino acid residues; the
theoretical molecular mass is 24,666 Da. The deduced amino acid
sequence of rmpB is similar to the deduced amino acid
sequence of PHI of M. aminofaciens 77a (66% similarity)
(16). rmpR was located upstream of
rmpB in the reverse orientation. The putative product of
this gene which encodes 223 amino acid residues (theoretical molecular
mass, 24,666 Da) shows similarity to many DNA-binding regulatory
proteins and contains a DNA-binding
-helix-turn-
-helix (HTH)
motif in the N-terminal region that is common in the gntR
family (6, 13). These data indicate that the rmpR
product most likely acts as a DNA-binding regulatory protein. The
deduced amino acid sequence of the partial ORF (rmpC) was
similar to that of glucose-6-phosphate dehydrogenase in
Mycobacterium leprae (84% similarity) (13) and
the same enzyme in Synechococcus sp. strain PCC7942 (82%) (12). This enzyme could play a critical role in the cleavage stage of a variant of the RuMP pathway (14). The function
and identity of orf1 could not be determined.

View larger version (26K):
[in this window]
[in a new window]
|
FIG. 1.
Gene diagram comparing the RuMP ORFs of
M. gastri MB19 (4,199 bp) (A) and M. aminofaciens
77a (4,451 bp) (B) (16). Genes: rmpA, a gene
which encodes HPS; rmpB, a gene which encodes PHI;
rmpC, a gene which encodes glucose-6-phosphate
dehydrogenase; rmpD, a gene which encodes transaldolase;
rmpI, a gene which encodes transposase (IS10-R);
rmpR, a gene which encodes regulatory protein; and
orf1, unknown. In the boxes, the arrows upstream of
rmpB indicate inverted repeat structures, and the putative
operators marked OE and OI indicate the
external and internal operators, respectively. The arrows downstream of
rmpA indicate the putative transcriptional terminator as an
inverted repeat. The numbering of nucleotides starts from the beginning
of the PstI fragment.
|
|
Two short stem-loop structures exist upstream of the transcriptional
start codon of rmpB and could encode a binding site for a
DNA-binding regulatory protein (possibly the product of
rmpR) as an operator (4). On the other hand, a
putative transcriptional terminator with subsequent T residues
(1) was observed downstream of the termination triplet of
rmpA. This sequence is characteristic of a rho-independent
transcriptional terminator (6). The structure and
organization of these three genes (rmpR, rmpB,
and rmpA) are similar to several operon structures in many
bacteria (5).
Expression of rmpA and rmpB in E. coli.
In order to confirm the products of rmpA
and rmpB, RmpA and RmpB were each expressed in E. coli under the control of a trp promoter. The cell
extract of E. coli which had been transformed with the
pT-rmpA or pT-rmpB plasmid exhibited a high level of HPS activity (210 µmol · min
1 · mg of
protein
1) or PHI activity (240 µmol · min
1 · mg of protein
1),
respectively. SDS-PAGE of the cell extract of E. coli which had been transformed with the pT-rmpA or pT-rmpB plasmid showed a major
distinctive protein band whose molecular mass was in close agreement
with the theoretical mass of the deduced amino acid sequences of HPS
and PHI, respectively (data not shown). The control strain harboring
pTTNco exhibited neither HPS activity nor PHI activity. Judging from
these findings, rmpA and rmpB encode HPS and PHI, respectively.
Transcriptional regulation of rmpA and rmpB
in M. gastri MB19.
M. gastri MB19 was grown
on media containing various carbon and nitrogen sources until the
middle log phase; the level of HPS and PHI activity in the cell
extracts was then measured (Fig. 2A). In
bacteria that had been grown on methanol as a carbon source, high HPS
activity and high PHI activity were present. Negligible HPS activity
and PHI activity were detected in cells that had been grown on a medium
which contained ethanol or glucose as a carbon source and an inorganic
nitrogen, (NH4)2SO4. On the other hand, considerable HPS activity and PHI activity were present in cells
that had been grown on a medium which contained methylamine as a
nitrogen source even when glucose or ethanol was used as the carbon
source. These data indicate that the expression of HPS and PHI is
induced by methanol or methylamine.

View larger version (36K):
[in this window]
[in a new window]
|
FIG. 2.
Level of HPS and PHI activity (A) and results
of Northern blot analysis of rmpA and rmpB gene
expression (B) in M. gastri MB19 that had been grown on
media with various nitrogen and carbon sources. M. gastri
MB19 were grown on media containing
methanol-(NH4)2SO4 (lanes 1 and 6),
ethanol-(NH4)2SO4 (lanes 2 and 7),
ethanol-methylamine (lanes 3 and 8),
glucose-(NH4)2SO4, or
glucose-methylamine (lanes 5 and 10). Probes 1 and 2 used in Northern
blot analysis are the entire coding regions of rmpA and
rmpB, respectively, in pUHM-1. Total RNA was extracted from
the cells grown on the media (1 to 10) described above. The hybridizing
bands were observed at the size of 1.5 kb, which was determined by the
comparison with the marker nucleotides.
|
|
To determine the transcriptional regulation of the rmpA and
rmpB genes, Northern blot analysis was performed on the
total RNA of M. gastri MB19 that had been grown on various
media with the DNA fragment of rmpA or rmpB as
the probe (Fig. 2B). Northern blot analysis of the methanol- and
methylamine-grown cells revealed hybridizing bands; the size of the
hybridizing band with the entire coding region of rmpA as
the probe and that with the entire coding region of rmpB as
the probe were identical and corresponded to the entire length of the
transcription product of rmpA and rmpB (1.5 kb).
On the other hand, the rmpA probe and rmpB probe
did not hybridize against the total RNA of cells that had been grown on
a medium which did not contain methanol or methylamine. These results
are in fair agreement with the enzyme induction profile described above
(Fig. 2A) and imply that expression of rmpA and rmpB is regulated at the mRNA level and that both genes are
transcribed as a polycistronic operon. Since methanol and methylamine
are each initially oxidized to formaldehyde in M. gastri
MB19, it is likely that formaldehyde induces the expression of both
rmpA and rmpB.
Comparison of the RuMP pathway gene cluster of M. gastri and M. aminofaciens 77a.
The organization
and regulation of the genes of the RuMP pathway differ in M. gastri MB19 (Fig. 1A) and in M. aminofaciens 77a, a
gram-negative and obligate methylotroph (Fig. 1B). The rmpA
and rmpB genes are well conserved in both organisms as
mentioned above, although the order of the rmpA and
rmpB genes on the chromosome of one organism is opposite
that of the other organism and the G+C content of rmpA and
rmpB differs (67.3% in M. gastri MB19 and 49.3%
in M. aminofaciens 77a). The characteristic difference between the two methylotrophs is the way in which rmpA and
rmpB expression is regulated. In M. aminofaciens
77a, the insertion sequence, rmpI, is present between
rmpA and rmpB, which are expressed monocistronically, and rmpI regulates the expression of the
adjacent genes in a unique manner. Activation of the inside promoters
of rmpI downregulates the expression of rmpA and
upregulates the expression of rmpB (16). In
contrast, in M. gastri MB19 the expression of
rmpA and rmpB is regulated under the same control at the mRNA level, as a polycistronic operon. This specific regulation system is necessary for the facultative methylotrophy of M. gastri MB19 that can grow on diverse carbon and nitrogen sources
(8). On the other hand, in an obligate methylotroph, it is
physiologically important that the HPS and PHI enzymes are synthesized
to result in an appropriate activity ratio for fixation of
formaldehyde, the sole source of cell constituents, to occur.
 |
DISCUSSION |
In this study, we identified the gene cluster of the RuMP pathway
in the gram-positive, facultative, methylotrophic bacterium, M. gastri MB19. In this region, the genes which encode a regulatory protein (rmpR), PHI (rmpB), and HPS
(rmpA) are aligned in this order from the 5' end. In
addition, rmpA and rmpB were polycistronically transcribed in M. gastri MB19 that had been grown on a
medium containing a C1 compound such as methanol or
methylamine. rmpR that codes a DNA-binding regulatory
protein participates possibly in the regulation of the polycistronic
transcription, although this has yet to be determined.
Database analyses revealed that the putative gene products of
rmpA and rmpB of M. gastri MB19 are
similar to those of diverse prokaryotes, not only among bacteria but
also among archaea (Fig. 3). For example,
the predicted genes yckG and yckF of
Bacillus subtilis (9) show high similarity to the
rmpA and rmpB genes, respectively, of both
M. gastri MB19 and M. aminofaciens 77a. Recently,
Yasueda et al. (23) found that the yckG and
yckF genes encode the enzymatically active forms of HPS and
PHI, respectively, and that they are expressed in the presence of
formaldehyde.

View larger version (34K):
[in this window]
[in a new window]
|
FIG. 3.
Phylogenetic analyses of the amino acid sequence of the
HPS protein (A) and PHI protein (B) by using the CLUSTAL W program via
the DDBJ saver (20). The similarity between the amino acid
sequence of the putative gene in the indicated organism found in the
database and the amino acid sequences of HPS and PHI of M. gastri MB19 was as follows: M. jannaschii (HPS, 57.3%;
PHI, 67.0%), M. thermoautotrophicum (HPS, 53.9%; PHI,
56.3%), A. fulgidus (HPS, 81.2%; PHI, 68.6%), P. horikoshii (HPS, 74.5%; PHI, 67.5%), B. subtilis
(HPS, 76.2%; PHI, 72.1%), H. influenzae (HPS, 58.0%; PHI,
43.0%), E. coli (HPS, 62.8%; PHI, 36.0%), M. pneumoniae (HPS, 64.8%), and C. perfringens (PHI,
48.9%).
|
|
A phylogenetic analysis of the amino acid sequence of the putative HPS
gene of bacteria with a sequence similar to that of HPS of M. gastri MB19 revealed that the HPS sequences could be divided into
three clusters: cluster I, archaea; cluster II, methylotrophs and
B. subtilis; and cluster III, other bacteria. The
phylogenetic tree of the amino acid sequence of the putative PHI gene
of bacteria with a sequence similar to that of PHI of M. gastri MB19 is also made up of three clusters (Fig. 3). Cluster I
of HPS and cluster I of PHI are composed of archaea, including the
methanogens Methanobacterium thermoautotrophicum
H and
Methanococcus jannaschii, the acetogen Archaeoglobus
fulgidus, and the hyperthermophile Pyrococcus
horikoshii. This implies that these two genes evolved as a pair.
Recently, Chistoserdova et al. (3) reported the existence of
a cluster of genes encoding anaerobic C1 transfer enzymes,
which had previously been thought to be unique to anaerobic metabolism
in methanogens and acetogens, in the chromosome of an aerobic
methylotroph, Methylobacterium extroquens AM1 (which has the
serine pathway of formaldehyde fixation). Our present study shows that
the formaldehyde fixation pathway in an aerobic methylotroph and that
in an anaerobic archaeon share common genes across the boundary between
bacteria and archaea.
Further studies on the RuMP gene cluster are necessary to elucidate the
evolutionary history of methylotrophy and fixation of formaldehyde into
organic compounds.
 |
ACKNOWLEDGMENTS |
This work was supported by grants from the Ministry of Education,
Science, Sports and Culture, Tokyo, Japan, to N.K. and Y.S.
 |
FOOTNOTES |
*
Corresponding author. Mailing address: Division of
Applied Life Sciences, Graduate School of Agriculture, Kyoto
University, Kitashirakawa Sakyo-ku, Kyoto 606-8502, Japan. Phone:
81-75-753-6385. Fax: 81-75-753-6128. E-mail:
nkato{at}kais.kyoto-u.ac.jp.
 |
REFERENCES |
| 1.
|
Abe, H., and H. Aiba.
1996.
Differential contributions of two elements of rho-independent terminator to transcription termination and mRNA stabilization.
Biochimie
78:1035-1042[Medline].
|
| 2.
|
Arfman, N.,
K. J. de Vries,
H. R. Moezelaar,
M. M. Attwood,
G. K. Robinson,
M. van Geel, and L. Dijkhuizen.
1992.
Environmental regulation of alcohol metabolism in thermotolerant methylotrophic Bacillus strains.
Arch. Microbiol.
157:272-278[CrossRef][Medline].
|
| 3.
|
Chistoserdova, L.,
J. A. Vorholt,
R. K. Thauer, and M. E. Lidstrom.
1998.
C1 transfer enzymes and coenzymes linking methylotrophic bacteria and methanogenic Archaea.
Science
281:99-102[Abstract/Free Full Text].
|
| 4.
|
Dahl, M. K.,
J. Degenkolb, and W. Hillen.
1994.
Transcription of the xyl operon is controlled in Bacillus subtilis by tandem overlapping operators spaced by four base-pairs.
J. Mol. Biol.
243:413-424[CrossRef][Medline].
|
| 5.
|
Gallegos, M. T.,
R. Schleif,
A. Bairoch,
K. Hofmann, and J. L. Ramos.
1997.
Arac/XylS family of transcriptional regulators.
Microbiol. Mol. Biol. Rev.
61:393-410[Abstract].
|
| 6.
|
Haydon, D. J., and J. R. Guest.
1991.
A new family of bacterial regulatory proteins.
FEMS Microbiol. Lett.
63:291-295[Medline].
|
| 7.
|
Kato, N.
1990.
3-Hexulose-6-phosphate synthase from Mycobacterium gastri MB19.
Methods Enzymol.
188:397-401[Medline].
|
| 8.
|
Kato, N.,
N. Miyamoto,
M. Shimao, and C. Sakazawa.
1988.
3-Hexulose phosphate synthase from a new facultative methylotroph, Mycobacterium gastri MB19.
Agric. Biol. Chem.
52:2659-2661.
|
| 9.
|
Kunst, F.,
N. Ogasawara,
I. Moszer,
A. M. Albertini,
G. Alloni,
V. Azevedo,
M. G. Bertero,
P. Bessieres,
A. Bolotin,
S. Borchert,
R. Borriss,
L. Boursier,
A. Brans,
M. Braun,
S. C. Brignell,
S. Bron,
S. Brouillet,
C. V. Bruschi,
B. Caldwell,
V. Capuano,
N. M. Carter,
S. Brouillet,
C. V. Bruschi,
B. Caldwell,
V. Capuano,
N. M. Carter,
S. K. Choi,
J. J. Codani,
I. F. Connerton,
N. J. Cummings,
R. A. Daniel,
F. Denizot,
K. M. Devine,
A. Dusterhoft,
S. D. Ehrlich,
P. T. Emmerson,
K. D. Entian,
J. Errington,
C. Fabret,
E. Ferrari,
D. Foulger,
F. Denizot,
K. M. Devine,
A. Dusterhoft,
S. D. Ehrlich,
P. T. Emmerson,
K. D. Entian,
J. Errington,
C. Fabret,
E. Ferrari,
D. Foulger,
K. D. Entian,
J. Errington,
C. Fabret,
E. Ferrari,
D. Foulger,
C. Fritz,
M. Fujita,
Y. Fujita,
S. Fuma,
A. Galizzi,
N. Galleron,
S. Y. Ghim,
P. Glaser,
A. Goffeau,
E. J. Golightly,
G. Grandi,
G. Guiseppi,
B. J. Guy,
K. Haga,
J. Haiech,
C. R. Harwood,
A. Henaut,
H. Hilbert,
S. Holsappel,
S. Hosono,
M. F. Hullo,
M. Itaya,
L. Jones,
B. Joris,
D. Karamata,
Y. Kasahara,
M. Klaerr-Blanchard,
C. Klein,
H. Hilbert,
S. Holsappel,
S. Hosono,
M. F. Hullo,
M. Itaya,
L. Jones,
B. Joris,
D. Karamata,
Y. Kasahara,
M. Klaerr-Blanchard,
C. Klein,
B. Joris,
D. Karamata,
Y. Kasahara,
M. Klaerr-Blanchard, and C. Klein.
1997.
The complete genome sequence of the gram-positive bacterium Bacillus subtilis.
Nature
390:249-256[CrossRef][Medline].
|
| 10.
|
Laemmli, U. K.
1970.
Cleavage of structural proteins during the assembly of the head of bacteriophage T4.
Nature
227:680-685[CrossRef][Medline].
|
| 11.
|
Marmur, J.
1961.
A procedure for the isolation of deoxyribonucleic acid from microorganisms.
J. Mol. Biol.
3:208-218.
|
| 12.
|
Newman, J.,
H. Karakaya,
D. J. Scanlan, and N. H. Mann.
1995.
A comparison of gene organization in the zwf region of the genomes of the cyanobacteria Synechococcus sp. PCC 7942 and Anabaena sp.
FEMS Microbiol. Lett.
133:187-193[CrossRef][Medline].
|
| 13.
|
Peekhaus, N., and T. Conway.
1998.
Positive and negative transcriptional regulation of the Escherichia coli gluconate regulon gene gntT by GntR and the cyclic AMP (cAMP)-cAMP receptor protein complex.
J. Bacteriol.
180:1777-1785[Abstract/Free Full Text].
|
| 14.
|
Quayle, J. R., and T. Ferenci.
1978.
Evolutionary aspects of autotrophy.
Microbiol. Rev.
42:251-273[Free Full Text].
|
| 15.
|
Sakai, Y.,
J. Ishikawa,
S. Fukasaka,
H. Yurimoto,
R. Mitsui,
H. Yanase, and N. Kato.
1999.
A new carboxylesterase from Brevibacterium linens IFO 12171 responsible for the conversion of 1,4-butanediol diacrylate to 4-hydroxybutyl acrylate. Purification, characterization, gene cloning and gene expression in Escherichia coli.
Biosci. Biotechnol. Biochem.
63:688-697[CrossRef][Medline].
|
| 16.
|
Sakai, Y.,
R. Mitsui,
Y. Katayama,
H. Yanase, and N. Kato.
1999.
Organization of the genes involved in the ribulose monophosphate pathway in an obligate methylotrophic bacterium, Methylomonas aminofaciens 77a.
FEMS Microbiol.
176:125-130[CrossRef].
|
| 17.
|
Sakai, Y.,
T. Nakagawa,
M. Shimase, and N. Kato.
1998.
Regulation and physiological role of the DAS1 gene encoding dihydroxyacetone synthase in the methylotrophic yeast, Candida boidinii.
J. Bacteriol.
180:5885-5890[Abstract/Free Full Text].
|
| 18.
|
Sambrook, J.,
E. F. Fritsch, and T. Maniatis.
1989.
Molecular cloning: a laboratory manual, 2nd ed.
Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y.
|
| 19.
|
Southern, E. M.
1975.
Detection of specific sequences among DNA fragments separated by gel electrophoresis.
J. Mol. Biol.
148:503-517.
|
| 20.
|
Thompson, J. D.,
D. G. Higgins, and T. J. Gibson.
1994.
CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting, position-specific gap penalties and weight matrix choice.
Nucleic Acids Res.
22:4673-4680[Abstract/Free Full Text].
|
| 21.
|
Yanase, H.,
K. Ikeyama,
R. Mitsui,
S. Ra,
K. Kita,
Y. Sakai, and N. Kato.
1996.
Cloning and sequence of the gene encoding 3-hexulose-6-phosphate synthase from the methylotrophic bacterium, Methylomonas aminofaciens 77a, and its expression in Escherichia coli.
FEMS Microbiol. Lett.
135:201-205[CrossRef][Medline].
|
| 22.
|
Yasueda, H.,
K. Nakanishi,
Y. Kumazawa,
K. Nagase,
M. Motoki, and H. Matsui.
1995.
Tissue-type transglutaminase from red sea beam (Pagrus major): sequence analysis of the cDNA and functional expression in Escherichia coli.
Eur. J. Biochem.
232:411-419[Medline].
|
| 23.
|
Yasueda, H.,
Y. Kawahara, and S. Sugimoto.
1999.
Bacillus subtilis yckG and yckF encode two key enzymes of the ribulose monophosphate pathway used by methylotrophs, and yckH is required for their expression.
J. Bacteriol.
181:7154-7160[Abstract/Free Full Text].
|
Journal of Bacteriology, February 2000, p. 944-948, Vol. 182, No. 4
0021-9193/00/$04.00+0
Copyright © 2000, American Society for Microbiology. All rights reserved.
This article has been cited by other articles:
-
Orita, I., Sato, T., Yurimoto, H., Kato, N., Atomi, H., Imanaka, T., Sakai, Y.
(2006). The Ribulose Monophosphate Pathway Substitutes for the Missing Pentose Phosphate Pathway in the Archaeon Thermococcus kodakaraensis. J. Bacteriol.
188: 4698-4704
[Abstract]
[Full Text]
-
Brautaset, T., Jakobsen, O. M., Flickinger, M. C., Valla, S., Ellingsen, T. E.
(2004). Plasmid-Dependent Methylotrophy in Thermotolerant Bacillus methanolicus. J. Bacteriol.
186: 1229-1238
[Abstract]
[Full Text]
-
Kotani, T., Yamamoto, T., Yurimoto, H., Sakai, Y., Kato, N.
(2003). Propane Monooxygenase and NAD+-Dependent Secondary Alcohol Dehydrogenase in Propane Metabolism by Gordonia sp. Strain TY-5. J. Bacteriol.
185: 7120-7128
[Abstract]
[Full Text]
-
Mitsui, R., Kusano, Y., Yurimoto, H., Sakai, Y., Kato, N., Tanaka, M.
(2003). Formaldehyde Fixation Contributes to Detoxification for Growth of a Nonmethylotroph, Burkholderia cepacia TM1, on Vanillic Acid. Appl. Environ. Microbiol.
69: 6128-6132
[Abstract]
[Full Text]
-
Moiseeva, O. V., Solyanikova, I. P., Kaschabek, S. R., Groning, J., Thiel, M., Golovleva, L. A., Schlomann, M.
(2002). A New Modified ortho Cleavage Pathway of 3-Chlorocatechol Degradation by Rhodococcus opacus 1CP: Genetic and Biochemical Evidence. J. Bacteriol.
184: 5282-5292
[Abstract]
[Full Text]
-
Tao, L., Tanzer, J.M.
(2002). Novel Sucrose-dependent Adhesion Co-factors in Streptococcus mutans. J. Dent. Res.
81: 505-510
[Abstract]
[Full Text]
-
Vorholt, J. A., Marx, C. J., Lidstrom, M. E., Thauer, R. K.
(2000). Novel Formaldehyde-Activating Enzyme in Methylobacterium extorquens AM1 Required for Growth on Methanol. J. Bacteriol.
182: 6645-6650
[Abstract]
[Full Text]