Previous Article | Next Article 
Journal of Bacteriology, April 2000, p. 2001-2009, Vol. 182, No. 7
0021-9193/00/$04.00+0
Copyright © 2000, American Society for Microbiology. All rights reserved.
Pyruvate Kinase of the Hyperthermophilic
Crenarchaeote Thermoproteus tenax: Physiological Role and
Phylogenetic Aspects
Alexander
Schramm,1
Bettina
Siebers,1
Britta
Tjaden,1
Henner
Brinkmann,2 and
Reinhard
Hensel1,*
Department of Microbiology, Universität
GH Essen, D-45117 Essen,1 and Institute
of Evolutionary Biology, Department of Biology, Universität
Konstanz, D-78547 Konstanz,2 Germany
Received 21 September 1999/Accepted 7 January 2000
 |
ABSTRACT |
Pyruvate kinase (PK; EC 2.7.1.40) of Thermoproteus
tenax was purified to homogeneity, and its coding gene was cloned
and expressed in Escherichia coli. It represents a
homomeric tetramer with a molecular mass of 49 kDa per subunit. PK
exhibits positive binding cooperativity with respect to
phosphoenolpyruvate and metal ions such as Mg2+ and
Mn2+. Heterotropic effects, as commonly found for PKs from
bacterial and eucaryal sources, could not be detected. The enzyme does
not depend on K+ ions. Heterotrophically grown cells
exhibit specific activity of PK four times higher than autotrophically
grown cells. Since the mRNA level of the PK coding gene is also
accordingly higher in heterotrophic cells, we conclude that the PK
activity is adjusted to growth conditions mainly on the transcript
level. The enzymic properties of the PK and the regulation of its
expression are discussed with respect to the physiological framework
given by the T. tenax-specific variant of the
Embden-Meyerhof-Parnas pathway. T. tenax PK shows moderate
overall sequence similarity (25 to 40% identity) to its bacterial and
eucaryal pendants. Phylogenetic analyses of the known PK sequences
result in a dichotomic tree topology that divides the enzymes into two
major PK clusters, probably diverged by an early gene duplication
event. The phylogenetic divergence is paralleled by a striking
phenotypic differentiation of PKs: PKs of cluster I, which occur in
eucaryal cytoplasm, some gamma proteobacteria, and low-GC gram-positive
bacteria, are only active in the presence of fructose-1,6-bisphosphate
or other phosphorylated sugars, whereas PKs of cluster II, found in
various bacterial phyla, plastids, and in Archaea, show
activity without effectors but are commonly regulated by the energy
charge of the cell.
 |
INTRODUCTION |
As shown by several investigations,
Archaea use the Embden-Meyerhof-Parnas (EMP) pathway for
carbon metabolism, and in some archaeal species (the genera
Pyrococcus, Thermococcus,
Desulfurococcus, and Thermoproteus) the catabolic
EMP pathway represents the main route for glucose degradation
(37, 40). So far, in thermophilic Archaea only
variants of the classical EMP pathway have been found. Common to
these variants is the irreversible oxidation step transforming glyceraldehyde-3-phosphate directly to 3-phosphoglycerate by
a ferredoxin-dependent glyceraldehyde-3-phosphate
oxidoreductase (GAP:FdOR) found in Pyrococcus,
Thermococcus, and Desulfurococcus strains
(37, 43) or by a nonphosphorylating
NAD+-dependent glyceraldehyde-3-phosphate dehydrogenase
(GAPN) found in Thermoproteus tenax (4, 15, 38).
These enzymes substitute for the combined action of conventional
phosphorylating
but reversible
glyceraldehyde-3-phosphate dehydrogenase (GAPDH) and 3-phosphoglycerate kinase, which, however, allows ATP formation.
We chose T. tenax, a hyperthermophilic, facultatively
heterotrophic member of the kingdom Crenarchaeota, as an
object for regulatory studies on archaeal carbohydrate metabolism.
T. tenax is able to grow chemolithoautotrophically on
CO2, H2 and S0, as well as
chemoorganoheterotrophically in the presence of S0 and
carbohydrates such as glucose, starch, and amylose (45). The
variant of the EMP pathway in T. tenax is characterized by a
bidirectionally working, nonallosteric pyrophosphate-dependent 6-phosphofructokinase (PPi-PFK) and by two GAPDHs differing
in their cosubstrate specificity (15, 39). Whereas the
phosphorylating NADP+-dependent GAPDH seems to fulfill a
role in gluconeogenesis (N. A. Brunner, B. Siebers, and R. Hensel,
manuscript in preparation), functional analyses of the
NAD+-dependent GAPDH (GAPN) of T. tenax revealed
that this enzyme is involved in glycolysis and represents a central
control point of the pathway (4). With its regulatory
properties (allosteric inhibition by NADP(H), NAD(H), and ATP;
allosteric activation by AMP, ADP, glucose-1-phosphate, and
fructose-6-phosphate), the enzyme seems to compensate for the missing
regulatory potential of PFK. To investigate whether the integration of
an irreversible, highly regulated GAPN in the catabolic EMP pathway of
T. tenax impacts the functional phenotype of PK, usually the
second site of glycolytic regulation, we focused on the enzymic
properties of PK and its expression in response to growth conditions.
In Bacteria and Eucarya, the enzyme is
functionally and structurally well characterized. In all
Eucarya spp. investigated so far and some bacteria, the
activity of PK depends on the presence of fructose-1,6-bisphosphate or
other sugar phosphates, whereas PKs of the majority of bacteria and
plastids show basal activity without effectors and are mostly regulated
by adenosine phosphates (i.e., by the energy charge of the cell). More
than 50 primary structures of bacterial and eucaryal enzymes are
available in databases. Three-dimensional structures have been
determined for one bacterial and three eucaryal enzymes (18, 24,
26, 29). Recently, the mode of ATP binding (23) and
allosteric activation of PK by FBP were described at the atomic level
(18). The enzyme is a homotetramer in almost all organisms,
although dimeric PKs have been reported for Schizosaccharomyces
pombe (30, 31) and Zymomonas mobilis
(32). Each subunit folds into four distinct domains
(designated N, A, B, and C). The first domain, N, is characterized by a
short
-helix at the N terminus, which, however, is absent in some
bacterial PKs, such as the FBP-activated enzyme of Escherichia coli (26). The catalytical A domain folds into the
common symmetrical
/
8-barrel, sharing this topology
with two other glycolytic enzymes: triosephosphate isomerase and
aldolase. The third domain, B, consists of a small
-barrel forming a
cap over the active site. Finally, domain C located at the C terminus
exhibits an
/
open-sheet motif and usually displays regulatory
functions. In contrast to bacterial and eucaryal enzymes, little is
known about the structure and function of archaeal PKs. Up to now only
the enzymic properties of the PK of Thermoplasma acidophilum
could be determined (34). The enzyme represents a homomeric
tetramer with a molecular mass of 250 kDa and displays cooperative
substrate binding; its substrate affinity is increased by AMP. Genome
sequencing projects published so far have revealed the presence of PK
coding genes (pyk) in Pyrobaculum aerophilum
(11), Methanococcus jannaschii (5), and Pyrococcus horikoshii (19), but no
information on the enzymic properties of these enzymes is available. By
analyzing T. tenax PK, we wanted to better understand the
control mechanisms governing the central carbon metabolism of that
organism and to get better insights into the structure and function of
the archaeal PK in general.
 |
MATERIALS AND METHODS |
Chemicals and plasmids.
Phosphoenolpyruvate (PEP) and rabbit
muscle lactate dehydrogenase (LDH) were from Sigma, Munich, Germany.
ADP, ATP, NAD+-NADH, and NADP+-NADPH were
purchased from Gerbu, Gaiberg, Germany. All other chemicals (Pro
Analysis grade) were from Sigma, Fluka, or Merck. Cloning of genomic
DNA was performed with plasmids pUC19 (MBI Fermentas) and pBluescript
IIKS(+) (Stratagene). For heterologous expression, the vector pJF118EH
(13) was used.
Bacterial strains and growth conditions.
Mass cultures of
T. tenax Kra 1 (DSM 2078) were grown as described previously
(38). For cloning and expression experiments, E. coli DH5
(Life Technologies) was grown as described earlier (36).
Enzyme assay.
The standard assay was performed at 50 or
60°C with 100 mM Tris-HCl (pH 7.0) at the respective temperature, 0.5 mM NADH, 4 U of LDH (rabbit muscle; Sigma), 20 mM PEP, 5 mM ADP, and 10 mM MgCl2. Enzyme activity was measured by monitoring the
decrease in absorption at 366 nm. Reactions were started by adding the heat-labile substrate PEP (Fig. 1).
Enzyme concentrations ranged from 2 to 10 µg of protein/ml. The
enzyme reaction was monitored for the first 1 to 2 min.

View larger version (10K):
[in this window]
[in a new window]
|
FIG. 1.
Arrhenius plot of PEP decay. A solution containing 50 mM
HEPES (pH 7.0)-10 mM PEP was incubated at various temperatures, and
the residual PEP concentration was determined by the enzyme assay
described in the text.
|
|
Purification of PK from T. tenax.
Preparation of crude
extracts from T. tenax, heat treatment, ion-exchange
chromatography, and hydrophobic interaction chromatography were
performed as described previously (40). Fractions containing PK activity were pooled, dialyzed against 50 mM HEPES-KOH (pH 7.0)
containing 10 mM 2-mercaptoethanol and 300 mM KCl, concentrated by
membrane filtration (Centricon 30; Amicon), and subjected to gel
filtration on a HiLoad 26/60 Superdex column (Pharmacia; 60 by 2.6 cm;
flow rate, 0.7 ml/min) equilibrated in the same buffer. Pooled
fractions containing PK activity were dialyzed and applied to a
AMP-Sepharose column (Sigma; 6 by 1 cm; flow rate, 0.2 ml/min) equilibrated with 50 mM HEPES (pH 7.0) and 10 mM 2-mercaptoethanol. Homogeneous protein was eluted by equilibration buffer containing 100 mM KCl. Sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) as described earlier (22). Determination of
protein concentration was done by using the DC Protein Assay (Bio-Rad).
Molecular mass determination.
The native molecular mass was
determined by gel filtration on a HiLoad 26/60 Superdex 200 preparatory-grade column (Pharmacia) as described elsewhere
(40). The molecular mass of subunits was determined by
denaturating SDS-PAGE with SDS-7 Marker (Sigma) as the standard.
CNBr fragmentation and protein sequencing.
Because the
enzyme turned out to be N-terminally blocked, the protein was cleaved
with CNBr (27). Resulting peptides were separated by
isoelectric focusing in the first dimension and by tricine-SDS-PAGE in
the second dimension as described previously (14). Peptides
and proteins were immobilized on ProBlott membranes (Applied
Biosystems) by semidry electrotransfer (10). Sequencing was
performed by automated Edman degradation with a gas-phase Sequenator
473A (Applied Biosystems). The partial sequence of the following two
peptides were determined: peptide 1, RPLQITAGARVSFKLAEKGDGFVPVPRREFF; and peptide 2, LDGKLVLRIISAAQ.
Cloning and sequencing of the coding gene.
Genomic DNA was
prepared as described earlier (44), as modified by Meakin et
al. (28). The gene encoding PK was identified by
hybridization with a degenerated oligonucleotide
5'-TTAGATGGIAARYTNGT3' deduced from the hexapeptide LDGKLV.
For hybridization, the oligonucleotide was labeled with digoxigenin
according to the manufacturer's instructions (Roche Diagnostics). DNA
was transferred to nylon membranes (Nytran; Schleicher & Schuell) by
capillary blotting (6). Southern blots were hybridized at
room temperature in 5× SSC (1× SSC is 0.15 M NaCl plus 0.015 M sodium
citrate) and washed two times at 37°C in 1× SSC. A strongly
hybridizing 3-kb BamHI/HindIII-fragment was
selected, cloned, and sequenced with the aid of an Automated Laser
Fluorescence DNA Sequencer (Amersham Pharmacia).
Expression of the pyk gene from T. tenax
in E. coli.
For expression of the pyk gene, the
coding region was cloned into pJF118EH via two new restriction sites
(EcoRI and BamHI) created with the mutagenic
primers 5'-GATCGCGCGAGTAGAATTCATGTTCAC-3' and
5'-GTTTACTCAGGGATCCGTAATTTAATAG-3'. The sequence of the
clone expressing the pyk gene was confirmed by sequencing of
both strands. Expression in E. coli DH5
cells was
performed by standard procedures (36).
Purification of T. tenax PK from transformed E. coli.
First, 5 g of E. coli cells was resuspended
in 10 mM potassium phosphate buffer (pH 7.3) containing 30 mM
2-mercaptoethanol and passed three times through a French press cell at
150 MPa. Then, after centrifugation (20,000 × g for 30 min), the supernatant was heat precipitated (80°C for 30 min) and
centrifuged again. Homogeneous enzyme preparations were obtained by
chromatography on AMP-Sepharose as outlined above for the enzyme
prepared from T. tenax.
Northern blot analyses.
Total RNA was prepared from
autotrophically and heterotrophically grown cells by using TRIzol
reagent according to the manufacturer's instructions (Life
Technologies, Eggenstein, Germany). The integrity of the RNA was
routinely checked by agarose gel electrophoresis by using a morpholine
propane sulfonic acid (MOPS)-6% formaldehyde buffer system, and the
concentration was determined spectrophotometrically at
= 260 nm. Digoxigenin-labeled antisense mRNA was obtained by in vitro
transcription from the T7 promoter of vector pSPT 19 (Roche
Diagnostics). For that purpose, the coding region of the T. tenax
pyk gene was inserted into the EcoRI/BamHI
restriction sites of the vector. Hybridization was carried out at
68°C overnight in DIG Easy Hyb solution (Roche Diagnostics), and
stringency washes were performed in 0.1× SSC-0.1% SDS at 68°C.
Densitometric analyses were performed by using a laser densitometer
Ultroscan XL (Pharmacia LKB) according to the manufacturer's instructions.
Primer extension analyses.
Primer extension was performed by
using a protocol of Kuo et al. (21), with the modification
that the hybridization buffer contained 0.3 M KCl, 2 mM EDTA, and 20 mM
Tris-HCl buffer (pH 8.3). RNA from heterotrophically as well as from
autotrophically grown cells of T. tenax was used as a source
for cDNA synthesis. To map the pyk transcription start site,
the 5'-32P-labeled antisense oligonucleotide PK1PEX
(5'-CCTCCGATGGCGATGCGT-3'), which is complementary to
positions 103 to 120 of the pyk gene, was used as primer for
cDNA synthesis and accompanying sequencing reactions. The labeled cDNA
products were analyzed on a denaturating polyacrylamide gel (5%),
along with a sequence ladder generated with the same oligonucleotide as
the primer.
Sequence handling and phylogenetic analyses.
Homology
searches were performed with BLASTN at The National Center for
Biotechnology Information (NCBI; http://www.ncbi.nlm.nih.gov/BLAST). Sequences were extracted from GenBank or from the NCBI, i.e., the
Microbial Genome Database
(http://www.ncbi.nlm.nih.gov/BLAST/unfinishedgenome.html), and first
aligned with CLUSTAL W (42). This alignment was refined manually by using the MUST program package (33). Regions of uncertain alignment were omitted, leaving 462 amino acid positions for
analysis. For the phylogenetic tree the topology of the Maximum Parsimony Bootstrap analysis was used, obtained by PAUP version 4.0d65
with 500 bootstrap replicates and four-times-random addition (41). Maximum likelihood analyses were performed by using
MOLPHY version 2.3 (1), starting with the NJDIST tree, using
the local rearrangement option (data not shown). Distance analysis were performed with the MUST package using the Kimura correction and the
neighbor-joining method (35), including 1,000 bootstrap replicates. The T. tenax pyk gene sequence is deposited at
GenBank (AF065890).
 |
RESULTS |
Specific activity of PK in autotrophically and heterotrophically
grown T. tenax cells, purification of the enzyme, and
molecular mass determination.
As revealed from measurements with
dialyzed crude extracts, cells grown in the presence of glucose showed
a specific activity of PK approximately four times higher (0.17 U/mg)
than cells grown with CO2 as the only carbon source (0.04 U/mg of protein), thus supporting its catabolic function. From 15 g (wet weight) of heterotrophically grown cells, 0.2 mg of homogeneous
protein was recovered with a specific activity of 45 U/mg, a value
corresponding to a recovery of 12% (Table
1). The enzyme migrated as a single band
on SDS-PAGE with an apparent molecular mass of 48 kDa (Fig.
2). Molecular mass determination under
nondenaturating conditions yielded values of 200 + 10 kDa,
indicating that the PK of T. tenax is a homomeric tetramer
like the majority of PKs known.

View larger version (81K):
[in this window]
[in a new window]
|
FIG. 2.
Purification of PK from T. tenax and of
recombinant PK. (M, marker; RE, crude extract; HF, heat precipitation;
QS, anion-exchange chromatography; PS, hydrophobic interaction
chromatography; GF, gel filtration; AMP, AMP-Sepharose).
|
|
Nucleotide sequence of the pyk gene and its flanking
regions.
Southern hybridizations with a degenerated
oligonucleotide probe derived from the N-terminal sequence of a
CNBr-fragment of the protein gave a strong positive signal with a 3-kb
BamHI/HindIII fragment of the genomic DNA of
T. tenax. Subsequent sequencing revealed two open reading
frames (see GenBank accession no. AF065890). One of them was identified
as a pyk gene by correspondence of the deduced amino acid
sequence with the partial peptide sequence and by sequence similarity
with known PKs from Bacteria and Eucarya. The
second open reading frame starting 116 bp downstream of the pyk gene (i.e., the same direction as pyk) showed
35 to 50% identity to cysteinyl-tRNA synthetases from other organisms
of the three domains of life.
The
pyk gene of
T. tenax consists of 1,341 bases
coding for a 49-kDa polypeptide of 446 residues (start codon, GTG; stop
codon,
TAA). The G+C content has been calculated to be 56%, a value
corresponding
very well with the average G+C content of the
T. tenax genome
(55.9% [
25]). Southern
hybridizations using a 1.3-kb
SacI fragment
comprising the
major part of the
pyk gene as a probe resulted
only in a
single positive signal with the genomic DNA digested
with several
restriction enzymes (data not shown), indicating
the presence of a
single
pyk homologue in
T. tenax.
Deduced amino acid sequence of PK.
Comprising only 446 residues, the T. tenax enzyme represents one of the shortest
PK sequences known. Like the protein sequences deduced from the
putative pyk genes of the Archaea P. horikoshii and M. jannaschii, the PK sequence of T. tenax is
about 10% shorter than those of Bacteria and
Eucarya. In an alignment with 52 representatives of the
three domains of life, the sequence of the T. tenax PK showed overall amino acid identities ranging from 27 to 42%. The comparison revealed that the catalytically essential residues (ARGDL)
at positions 236 to 240 and residues involved in subunit binding
(PTRAE) at positions 283 to 287 (Fig. 3;
assigned on the basis of three-dimensional analyses of the PK from
yeast [18]) are conserved in the T. tenax
enzyme. These conservative residues are located in the domains A and B. Surprisingly, no preferred similarity to the translated sequences of
the putative pyk genes of the Archaea P. aerophilum, M. jannaschii, and P. horikoshii were observed: the archaeal sequences neither shared specific sequence
signatures nor showed significantly higher identity values with each
other (28.4 to 36.2% identity) than with the homologues of
Bacteria or Eucarya.

View larger version (13K):
[in this window]
[in a new window]
|
FIG. 3.
Partial sequence alignment of PK from T. tenax with PKs from eucaryal, bacterial, and archaeal
representatives. GenBank entries: YEAST, S. cerevisiae
(U12980); CAEEL, C. elegans (Z69385); ECOLI1, E. coli PK1 (AE000262); ECOLI2, E. coli; PK2 (AE000279);
METJA, M. jannaschii (U67468). THETX, T. tenax
(the present study). Conserved residues are marked with an asterisk.
Residues in boldface type indicate potassium binding sites (A) or
subunit and metal binding sites (B), respectively. The secondary
structure elements above the sequences are deduced from the
three-dimensional structure of yeast enzyme (18).
|
|
Transcript analyses.
Northern blot analyses with total RNA
from autotrophically and heterotrophically grown cells using antisense
pyk mRNA as a probe resulted in a strong hybridization
signal with a 1.3-kb and
to a significantly lesser extent
with a
1.6-kb transcript (Fig. 4A). As revealed
by densitometric analyses, the 1.3-kb transcript gave a signal
approximately four times stronger with heterotrophic cells compared to
autotrophic cells, thus corresponding well with the fourfold-higher PK
activity in heterotrophically grown cells. In contrast, the signal of
the 1.6-kb transcript remained at a rather low level under both growth
conditions (Fig. 4A). Whether this significantly weaker signal can be
assigned to a transcript initiated from an alternative promoter of the
pyk gene is currently being analyzed.

View larger version (45K):
[in this window]
[in a new window]
|
FIG. 4.
Northern blot analysis of pyk mRNA and
determination of the transcript start site. (A) Northern blot analysis
of pyk transcripts with RNA from autotrophically (lane 1)
and heterotrophically (lane 2) grown cells probed with pyk
antisense mRNA. (B) Mapping of the pyk transcription start
by primer extension. The transcript begins at position 1 with regard
to the start codon of the pyk gene (marked by an asterisk).
The primer extension products from autotrophically grown cells (lane 1)
and heterotrophically grown cells (lane 2), together with the sequence
ladder (lanes A, C, G, and T), are shown. (C) Nucleotide sequence of
the sense strand of the pyk region. The position of a
putative box A promoter element (marked in boldface) and the starting
point of transcription (marked by an arrow) are indicated.
|
|
Using the oligonucleotide binding at positions 103 to 120 of the
pyk gene, the start site of the shorter transcript was
determined
to be at the thymidine immediately in front of the gene
(Fig.
4B). Corresponding with the Northern blot signals observed with
the 1.3-kb transcript, the primer extension signal with RNA from
cells
grown under heterotrophic conditions showed a significantly
higher
intensity than that obtained with autotrophically grown
cells, thus
confirming the higher
pyk transcript level in heterotrophic
cells.
Heterologous expression of the pyk gene.
For
functional and structural investigations, the pyk gene was
expressed in E. coli. About 1 mg of homogeneous enzyme could be obtained from 1 g (wet weight) of recombinant E. coli DH5
cells. As shown in Fig. 2 and Table
2, the enzyme isolated from T. tenax and from transformed E. coli exhibited virtually
the same properties with respect to molecular mass and the kinetic parameters for substrate, cosubstrate, and Mg2+ saturation,
indicating a highly similar phenotype for both enzymes. Therefore, the
screening experiments for ligands influencing the enzymic properties
were performed with the better available recombinant enzyme.
Enzymic properties.
The enzyme assays were conducted at only
50°C because of the heat-labile mesophilic auxiliary enzyme used in
the coupled optical test. Like known PKs, the enzyme of T. tenax showed an absolute requirement for divalent cations.
However, of the metal ions tested (Mg2+, Mn2+,
Co2+, Fe2+, Ni2+, and
Cd2+), activity could only be observed with
Mg2+, Mn2+, and Co2+. The highest
Vmax values were obtained with Mn2+
and Mg2+ (Table 2). Co2+ allowed only one-tenth
of the maximal activity.
Saturation kinetics were followed with Mg
2+,
Mn
2+, PEP, and ADP. Whereas the enzyme exhibited classical
saturation kinetics with
cosubstrate, sigmoidal saturation curves were
obtained with substrate
and metal ions, indicating the positive
cooperative binding of
these ligands (Fig.
5 and Table
2). Mg
2+ showed
the highest binding cooperativity measured at all (Hill
coefficient
[h] = 2.8). The cooperativity of substrate binding
was dependent on
the metal ion added and was more pronounced in
the presence of
Mg
2+ (h = 2.0) than with Mn
2+ (h = 1.6). The activity of the enzyme did not depend on potassium
ions.
None of the common effectors of known PKs influenced the activity of
T. tenax PK. Neither activation nor inhibition of the
enzyme
activity could be observed with the following compounds
(concentration
range, 10 µM to 10 mM; assay in the presence of
half-saturating
substrate and cosubstrate concentration): FBP,
fructose-6-phosphate, ribose-5-phosphate, glucose-1-phosphate,
glucose-6-phosphate, glucose, trehalose, citrate,
sedoheptulose-7-phosphate,
erythrose-4-phosphate,
3-phosphoglycerate, 2,3-bisphosphoglycerate,
glyceraldehyde-3-phosphate, dihydroxyacetone phosphate,
NADP
+, NADPH, NAD
+, NADH, phenylalanine,
alanine, AMP, ATP, P
i, and PP
i.
Phylogenetic analyses.
Phylogenetic trees were constructed
based on the deduced amino acid sequences of 52 pyk genes
from Bacteria, Eucarya, and Archaea by
using maximum parsimony, distance matrix, and maximum likelihood (ML)
methods. The tree in Fig. 6 was
constructed based on the topology of the PAUP bootstrap consensus tree
using the user-defined tree option of the MOLPHY package. All three
methods resulted in the same dichotomic tree structure, dividing the PK enzymes into two discrete clusters. PK cluster I contains all sequences
of the eucaryal cytoplasm, all sequences of low-GC gram-positive bacteria, and some of the gamma proteobacteria, whereas PK cluster II
includes members of most bacterial phyla (except of low-GC gram-positive bacteria), plastids, and Archaea.

View larger version (47K):
[in this window]
[in a new window]
|
FIG. 6.
Phylogenetic tree of PK. The tree was constructed by
using the user-defined tree option of the MOLPHY package
(1), based on the topology of the PAUP* Bootstrap Consensus
tree (41). The numbers at certain nodes are bootstrap
proportions; upper values correspond to the PAUP* Bootstrap analysis
(500 replicates, four-times-random addition), and lower values
correspond to the Kimura distance neighbor-joining analysis (1,000 replicates). Only values of >40% are shown in the figure. The
sequence of the T. tenax PK is shown in boldface. The
accession numbers for all PK sequences used for the phylogenetic
analysis that were found in GenBank, in addition to sequences that were
identified by BLAST search and downloaded at the NCBI, were as follows:
Xenopus sp. (U03878), Gallus gallus (J00903),
Caenorhabditis elegans 1 (Z69385), Caenorhabditis
elegans 2 (Z81068), Drosophila melanogaster (AF06247),
Saccharomyces cerevisiae 1 (U12980), Saccharomyces
cerevisiae 2 (Z75255), Trichoderma reesei (L07060),
Aspergillus niger (S38698), Schizosaccharomyces
pombe (Z69380.1), Trypanoplasma borrelii (X77255),
Leishmania mexicana (X74944), Trypanosoma brucei
(X57951), Solanum tuberosum (cytosol, JC1481), Glycine
max (cytosol, L08632), Arabidopsis thaliana (cytosol,
AL022223), Nicotiana tabacum (cytosol, Z29492),
Escherichia coli type I (AE000262), Salmonella
typhimurium (X99945), Bacillus stearothermophilus
(D13095), Bacillus psychrophilus (D31954),
Lactobacillus delbrueckii (X71403), Ricinus
communis 1 (chloroplast, M64737), Nicotiana tabacum 1 (chloroplast, Z28374), Ricinus communis 2 (chloroplast,
M64736), Nicotiana tabacum 2 (chloroplast, Z28373),
Borrelia burgdorferi (AE001141), Mycoplasma
pneumoniae (AE000052), Mycoplasma genitalium (U39698),
Chlamydia trachomatis (AE001306), Methanococcus
jannaschii (U67468), Pyrococcus horikoshii (AP000002),
Haemophilus influenzae (U32831), Escherichia coli
type II (AE000279), Agrobacterium vitis 1 (U32375),
Agrobacterium vitis 2 (U25634), Methylobacterium
extorquens (U87316), Zymomonas mobilis (AF079586),
Mycobacterium intracellulare (U65430), Mycobacterium
tuberculosis (Z95554), Corynebacterium glutamicum
(L27126), Synechocystis sp. strain 1 (D90907), and
Synechocystis sp. strain 2 (D64004).
|
|
Generally, the topology of the PK cluster I is supported by fairly good
bootstrap values for both maximum parsimony and neighbor-joining
analysis. The position of the PK cluster I of
E. coli and
Salmonella typhimurium, however, remained ambiguous in being
either the closest
relatives to the eucaryal PK sequences or in some
analysis branching
together with the low-GC gram-positive bacteria (ML
analysis [data
not shown]). In contrast, the deeper branching
lineages of PK
cluster II are only poorly resolved and are not
confirmed by high
bootstrap values. The monophyly of
Archaea
could not be confirmed
either by neighbor-joining or by ML analysis
(data not shown).
On the other hand, both the maximum parsimony and the
distance
matrix methods found several clearly separated groups that are
in agreement with rRNA-based phylogeny, e.g., alpha proteobacteria,
beta and gamma proteobacteria, high-GC gram-positive bacteria,
and
low-GC gram-positive
bacteria.
 |
DISCUSSION |
Functional and structural properties of PK of T. tenax
and its coding gene.
With the T. tenax enzyme, an
archaeal PK could be assigned for the first time to its coding gene.
Common to known PKs, the T. tenax enzyme is N-terminally
blocked. As shown, however, by comparing the enzymic properties of the
PK purified from T. tenax with those of the recombinant
enzyme, the putative N-terminal modification does not influence the
functional properties of PK.
A rather rare feature of PK is that the
T. tenax enzyme does
not depend on potassium ions. Interestingly, one of the two sequence
motifs characteristic for K
+ binding in
K
+-dependent PKs (LDTKGPEIRT; positions 83 to 92 (Fig.
3); numbering
is according to the yeast enzyme
[
18]) is changed in a similar
way, as observed with
the K
+-insensitive PKs of
E. coli (PKII of
E. coli) and
Corynebacterium glutamicum
(
17). The nonsusceptibility of the
T. tenax PK
toward
heterotropic effectors also seems rather exceptional. A similar
reduced regulatory potential has only been described for the PKs
of
Schizosaccharomyces pombe (
30) and
Zymomonas mobilis (
32).
As a consequence of the N-terminal blockage, the translation start of
the
T. tenax PK could not be determined directly. The
most
probable initiation codon is GUG at positions 261 to 263
(GenBank
accession no.
AF065890), immediately following the
transcription start
of the
pyk gene at T
260 (Fig.
4C). As shown
in
several cases, GUG functions also in
Archaea as (although
rare)
an initiation triplet coding for methionine. The proposed
position
of the translation start is confirmed by the observation that
the following nucleotide sequence codes for amino acid sequence
FTKIV,
which could be unequivocally assigned to the highly conserved
first

-strand of the

/
8-barrel of the catalytic PK
domain A
(bacterial consensus, TKI/LV/I), characterizing this region as
an integral part of the coding gene. The close proximity of translation
and transcription start of the
pyk gene corresponds with the
observation
that especially some
Archaea contain a high
portion of mRNAs lacking
Shine-Dalgarno sequences in front of the
coding genes. The mechanism,
however, allowing translation initiation
independent of Shine-Dalgarno
motifs is still unknown (
7).
Northern blot analyses and primer extension studies suggest that the
pyk gene of
T. tenax is preferably transcribed
under
heterotrophic growth conditions supporting the catabolic function
of the enzyme. Determination of the transcription start point,
together
with the length of the predominant transcript observed
in Northern blot
studies, suggest that the
pyk transcript is
monocistronic.
Phylogeny.
One of the most striking features of the
phylogenetic tree based on PK sequences is its dichotomic topology.
Interestingly, this topology coincides with the differentiation of PK
enzymes into two basic phenotypes. Thus, as known so far, all PK
cluster I enzymes are active only in the presence of
fructose-1,6-bisphosphate and/or other sugar phosphates, whereas the PK
cluster II enzymes possess basal activity also without effectors but
are mostly regulated by AMP and ATP, i.e., by the energy charge of the
cell. The PK of T. tenax fits very well into this framework:
like other PK II enzymes, the enzyme does not need heterotropic
effectors for activity.
The dichotomic structure of the phylogenetic PK tree does not coincide
with any of the four possible rooted universal tree
topologies
(
9). The presence of PK enzymes from related bacteria
(e.g.,
gamma proteobacteria or gram-positive bacteria) and even
from the same
organism (
E. coli) in both clusters instead suggests
that
the dichotomic tree topology is caused by an early gene duplication
event probably prior to the diversification of
Bacteria.
Since,
however, in each cluster members of only two domains are
present,
we cannot definitely decide whether the two lineages trace
back
to the common ancestor or whether the duplication occurred after
the domains had been segregated and the observed relationship
is the
result of lateral gene transfer events between domains.
Examples of
more recent gene duplication events are found in the
lineages leading
to
Caenorhabditis elegans,
Saccharomyces
cerevisiae,
Clostridium acetobutylicum,
Agrobacterium vitis, and
Synechocystis spp.
Pseudomonas aeruginosa PK cluster II, which clusters with
the alpha proteobacterial group, could serve as an example for
a more
recent lateral gene
transfer.
For both eucaryal cytoplasmic PKs and archaeal enzymes, in contrast to
Bacteria, only one PK isoform could be found: PK cluster
I
enzymes in
Eucarya versus PK cluster II enzymes in
Archaea.
Because of the rather limited number of known PK
sequences and
completed genome projects in
Archaea, we
cannot clearly decide
whether the second type is generally missing in
that domain caused
by an early loss or if it is just not yet detected
due to the
rather limited sequence information. The quite extensive
data
set for eucaryal PK seems to exclude the latter explanation for
the exclusive occurrence of PK cluster I enzymes in the eucaryal
cytoplasm, suggesting rather that
Eucarya are, a priori,
equipped
only with one PK type, PK cluster I, probably inherited from
an
ancestral alpha proteobacterium via endosymbiosis. This assumption
may explain the close affinity of the eucaryal and proteobacterial
PKs
documented in PK cluster I. Presumably, the PK cluster I encoding
gene

like other genes coding for metabolic enzymes such as
triosephosphate
isomerase (
20), GAPDH (
16), and
3-PGK (
3)

also represents
a constituent of the bacterial
inheritance of the eucaryal
genome.
The rather poor resolution of the deeper rooting branches in PK cluster
II leading to artificial associations may be, at least
partially,
caused by considerable differences in evolutionary
rates of the PK
sequences. Thus, unexpectedly, according to both
parsimony and distance
matrix analyses, the plastid PKs do not
cluster together with the
enzymes from cyanobacteria, whereas
the monophyly of
Archaea
could not be confirmed by distance matrix
and ML analyses. Possibly,
the high evolutionary rates of the
enzymes from plastids and the
pathogenic strains of
Borrelia,
Chlamydia, and
Mycoplasma (due to adaptation to specific cellular
environments) lead to long-branch attraction covering their true
phylogenetic relationships and resulting in the observed association
of
both enzyme groups. On the other hand, the slower evolutionary
rates of
the
Pyrococcus enzyme compared to those of
Methanococcus and both crenarchaeotal species may be the
cause for its separation
from the archaeal cluster in distance matrix
and ML
analyses.
Physiological role.
The PKs of Bacteria and
Eucarya represent the second control point of the catabolic
EMP pathway adjusting the level of glycolytic intermediates for
degradation or biosynthetic purposes and, by controlling the flux
through the pathway, also regulating the level of ATP and GTP in the
cell. To adapt immediately to changing intracellular and extracellular
conditions, the PK activity is, like the ATP-dependent PFK, controlled
at the protein level, mainly by allosteric mechanisms, whereas
long-term adaptation is achieved on the gene level. As a typical
catabolic enzyme, the expression of its coding gene is significantly
reduced under anabolic conditions to avoid futile cycling of PEP
(8).
As found for bacterial and eucaryal systems, the PK activity in
T. tenax is strongly regulated at the transcript level: in
heterotrophically grown cells both
pyk-specific mRNA and the
specific
enzyme activity are four times higher than in autotrophically
grown cells, clearly underlining the catabolic role of the enzyme.
In
contrast, the
T. tenax enzyme differs from most bacterial
and
eucaryal enzymes by its reduced allosteric regulation, which seems
to be restricted to positive binding cooperativity for PEP and
divalent
metal cations. At least the cooperative binding of PEP
could possess
some physiological relevance by enabling the enzyme
to switch on its
activity only at a PEP concentration exceeding
a certain threshold.
Thus, from the kinetic properties of the
enzyme, one could expect an
accumulation of PEP and preceding
intermediates only up to ~1 mM.
Higher concentrations would activate
the enzyme, leading to a
concomitant decrease of the intermediate
pools. Obviously, the limited
regulation capacity of the
T. tenax PK should only ascertain
a minor accumulation of intermediates
for biosynthetic purposes, but it
does not allow a stronger dam
of intermediates, which could drive the
carbon flux into anabolic
direction as assumed for the bacterial and
eucaryal systems (
24).
The absence of a stringent throttle valve as a regulatory unit at the
last step of the pathway in
T. tenax, which does not
allow a
considerable accumulation of intermediates, seems to be
favorable under
thermoadaptive aspects. Considering the heat instability
of several
glycolytic intermediates (PEP, 1,3-bisphosphoglycerate,
glyceraldehyde-3-phosphate, and dihydroxyacetone phosphate), the
accumulation of free intermediates at high temperatures would
result in
an accelerated loss of these compounds and must therefore
be avoided.
The integration of nonphosphorylating GAPDH (GAPN)
in the catabolic
route of glycolysis is an important feature of
metabolic
thermoadaptation. This enzyme seems to serve thermoadaptive
purposes in
a two-fold manner: (i) by its allosteric properties
(
4)
compensating not only the missing allosteric potential
of the
reversible PP
i-PFK but also the reduced regulatory
potential
of PK and thus allowing the catabolism to take place without
a
bottleneck at the last step and (ii) by avoiding the formation
of the
highly labile intermediate 1,3-bisphosphoglycerate. As
outlined above,
the direct oxidation of glyceraldehyde-3-phosphate
to
3-phosphoglycerate by GAPN is paid for with the loss of 2 mol
of
ATP/mol of glucose, which could be gained by using the phosphorylating
GAPDH. Possibly, the reduced energy yield of the catabolic EMP
pathway
in
T. tenax is compensated for by using PP
i
instead of
ATP as phosphoryl donor for the PFK reaction. Thus, all
three
striking features, by which the catabolic EMP variant of
T. tenax differs from the classic glycolytic pathway
(PP
i-dependent PFK,
nonphosphorylating GAPN, and weakly
regulated PK), could be related
to thermoadaptation. Pool
determinations of the various intermediates,
as well as kinetic and
regulatory investigations with other EMP
enzymes, will show whether the
presumed thermoadaptive background
of the EMP variant in
T. tenax can be
confirmed.
 |
ACKNOWLEDGMENTS |
We are indebted to Roland Schmid (Universität
Osnabrück, Osnabrück, Germany) for protein sequencing.
The work was supported by grants of the Deutsche Forschungsgemeinschaft
and the Fonds der Chemischen Industrie.
 |
FOOTNOTES |
*
Corresponding author. Mailing address: FB 9 Mikrobiologie, Universität GH Essen, Universitätsstr. 5, 45117 Essen, Germany. Phone: 49-201-183-3442. Fax: 49-201-183-3990. E-mail: r.hensel{at}uni-essen.de.
 |
REFERENCES |
| 1.
|
Adachi, J., and M. Hasegawa.
1996.
MOLPHY version 2.3: programs for molecular phylogenetics based on maximum likelihood. Computer Science Monographs no. 28.
Institute of Statistical Mathematics, Tokyo, Japan.
|
| 2.
|
Branny, P.,
F. de la Torre, and J.-F. Garel.
1996.
The genes for phosphofructokinase and pyruvate kinase of Lactobacillus delbrueckii subsp. bulgaricus constitute an operon.
J. Bacteriol.
178:4727-4730[Abstract/Free Full Text].
|
| 3.
|
Brinkmann, H., and W. Martin.
1996.
Higher-plant chloroplast and cytosolic 3-phosphoglycerate kinases: a case of endosymbiotic gene replacement.
Plant Mol. Biol.
30:65-75[CrossRef][Medline].
|
| 4.
|
Brunner, N. A.,
H. Brinkmann,
B. Siebers, and R. Hensel.
1998.
NAD+-dependent glyceraldehyde-3-phosphate dehydrogenase from Thermoproteus tenax: the first identified member of the aldehyde dehydrogenase superfamily is a glycolytic enzyme with unusual regulatory properties.
J. Biol. Chem.
273:6149-6156[Abstract/Free Full Text].
|
| 5.
|
Bult, C. J.,
O. White,
G. J. Olsen,
L. Zhou,
R. D. Fleischmann,
G. G. Sutton,
J. A. Blake,
L. M. Fitzgerald,
R. A. Clayton,
J. D. Gocayne,
A. R. Kervelage,
B. A. Dougherty,
J.-F. Tomb,
M. D. Adams,
C. I. Reich,
R. Overbeek,
E. F. Kirkness,
K. G. Weinstock,
J. M. Merrick,
A. Glodek,
J. L. Scott,
N. S. M. Geoghagen,
J. F. Weidman,
J. L. Fuhrmann,
D. Nguyen,
T. R. Utterback,
J. M. Kelley,
J. D. Peterson,
P. W. Sadow,
M. C. Hanna,
M. D. Cotton,
K. M. Roberts,
M. A. Hurst,
B. P. Kaine,
M. Borodovsky,
H.-P. Klenk,
C. M. Fraser,
H. O. Smith,
C. R. Woese, and J. C. Venter.
1996.
Complete genome sequence of the methanogenic archaeon, Methanococcus jannaschii.
Science
273:1058-1073[Abstract].
|
| 6.
|
Chomczynski, P.
1992.
One-hour downward alkaline capillary transfer for blotting of DNA and RNA.
Anal. Biochem.
14:134-139.
|
| 7.
|
Condo, I.,
A. Ciammaruconi,
D. Benelli,
D. Ruggero, and P. Londei.
1999.
cis-acting signals controlling translational initiation in the thermophilic archaeon Sulfolobus solfataricus.
Mol. Microbiol.
34:377-384[CrossRef][Medline].
|
| 8.
|
DeRisi, J. L.,
V. R. Iyer, and P. O. Brown.
1997.
Exploring the metabolic and genetic control of gene expression on a genomic scale.
Science
278:680-686[Abstract/Free Full Text].
|
| 9.
|
Doolittle, W. F., and J. R. Brown.
1994.
Tempo, mode, the progenote, and the universal root.
Proc. Natl. Acad. Sci. USA
91:6721-6728[Abstract/Free Full Text].
|
| 10.
|
Eckerskorn, C.,
W. Mewes,
H. Goretzki, and F. Lottspeich.
1988.
A new siliconized glass fiber as support for chemical analysis of electroblotted proteins.
Eur. J. Biochem.
176:509-519[Medline].
|
| 11.
|
Fitz-Gibbon, S.,
A. J. Choi,
J. H. Miller,
K. O. Stetter,
M. I. Simon,
R. Swanson, and U. J. Kim.
1997.
A fosmid-based genomic map and identification of 474 genes of the hyperthermophilic archaeon Pyrobaculum aerophilum.
Extremophiles
1:36-51[CrossRef][Medline].
|
| 12.
|
Fothergill-Gilmore, L. A., and P. A. M. Michels.
1993.
Evolution of glycolysis.
Prog. Biophys. Mol. Biol.
59:105-235[CrossRef][Medline].
|
| 13.
|
Fürste, J. P.,
W. Pansegrau,
R. Frank,
H. Blöcker,
P. Scholz,
M. Bagdasarian, and E. Lanka.
1986.
Molecular cloning of the plasmid RP4 primase region in a multi-host-range tacP expression vector.
Gene
48:119-131[CrossRef][Medline].
|
| 14.
|
Görg, A.,
W. Postel, and S. Günther.
1988.
Two-dimensional electrophoresis. The current state of two-dimensional electrophoresis with immobilized pH gradients.
Electrophoresis
9:531-546[CrossRef][Medline].
|
| 15.
|
Hensel, R.,
S. Laumann,
J. Lang,
H. Heumann, and F. Lottspeich.
1987.
Characterization of two D-glyceraldehyde-3-phosphate dehydrogenases from the extremely thermophilic archaebacterium Thermoproteus tenax.
Eur. J. Biochem.
170:325-333[Medline].
|
| 16.
|
Hensel, R.,
P. Zwickl,
S. Fabry,
J. Lang, and P. Palm.
1989.
Sequence comparison of glyceraldehyde-3-phosphate dehydrogenases from the three urkingdoms: evolutionary implication.
Can. J. Microbiol.
35:81-85[Medline].
|
| 17.
|
Jetten, M. S.,
M. E. Gubler,
S. H. Lee, and A. J. Sinskey.
1994.
Structural and functional analysis of pyruvate kinase from Corynebacterium glutamicum.
Appl. Environ. Microbiol.
60:2501-2507[Abstract/Free Full Text].
|
| 18.
|
Jurica, M. S.,
A. Mesecar,
P. J. Heath,
W. Shi,
N. Nowak, and B. L. Stoddard.
1998.
The allosteric regulation of pyruvate kinase by FBP.
Structure
6:195-210[Medline].
|
| 19.
|
Kawarabayasi, Y.,
M. Sawada,
H. Horikawa,
Y. Haikawa,
Y. Hino,
S. Yamamoto,
M. Sekine,
S. Baba,
H. Kosugi,
A. Hosoyama,
Y. Nagai,
M. Sakai,
K. Ogura,
R. Otuka,
H. Nakazawa,
M. Takamiya,
Y. Ohfuku,
T. Funahashi,
T. Tanaka,
Y. Kudoh,
J. Yamazaki,
N. Kushida,
A. Oguchi,
K. Aoki,
Y. Nakamura,
T. F. Robb,
K. Horikoshi,
Y. Masuchi,
H. Shizuya, and H. Kikuchi.
1998.
Complete sequence and gene organization of the genome of a hyperthermophilic archaebacterium, Pyrococcus horikoshii OT3.
DNA Res.
5:55-76[Abstract].
|
| 20.
|
Keeling, P. J., and W. F. Doolittle.
1997.
Evidence that eukaryotic triosephosphate isomerase is of alpha-proteobacterial origin.
Proc. Natl. Acad. Sci. USA
94:1270-1275[Abstract/Free Full Text].
|
| 21.
|
Kuo, Y. P.,
D. K. Thompson,
A. St. Jean,
R. L. Charlebois, and C. J. Daniels.
1997.
Characterization of two heat shock genes from Haloferax volcanii: a model system for transcription regulation in the Archaea.
J. Bacteriol.
179:6318-6324[Abstract/Free Full Text].
|
| 22.
|
Laemmli, U. K.
1970.
Cleavage of structural proteins during the assembly of the head of bacteriophage T4.
Nature
277:680-685.
|
| 23.
|
Larsen, T. M.,
M. M. Benning,
I. Rayment, and G. H. Reed.
1998.
Structure of the bis(Mg2+)-ATP-oxalate complex of the rabbit muscle pyruvate kinase at 2.1 Å resolution: ATP binding over a barrel.
Biochemistry
37:6247-6255[CrossRef][Medline].
|
| 24.
|
Larsen, T. M.,
L. T. Laughlin,
H. M. Holden,
I. Rayment, and G. H. Reed.
1994.
Structure of rabbit muscle pyruvate kinase complexed with Mn2+, K+, and pyruvate.
Biochemistry
33:6301-6309[CrossRef][Medline].
|
| 25.
|
Leinfelder, W.,
M. Jarsch, and A. Böck.
1985.
The phylogenetic position of the sulfur-dependent archaebacterium Thermoproteus tenax: sequence of its 16S rRNA gene.
System. Appl. Microbiol.
6:164-170.
|
| 26.
|
Mattevi, A.,
G. Valentini,
M. Rizzi,
M. L. Speranza,
M. Bolognesi, and A. Coda.
1995.
Crystal structure of Escherichia coli pyruvate kinase type I: molecular basis of the allosteric transition.
Structure
3:729-41.
|
| 27.
|
Matsudaira, P.
1990.
Limited N-terminal sequence analysis.
Methods Enzymol.
182:602-613[Medline].
|
| 28.
|
Meakin, S. A.,
J. Nash,
W. D. Murray,
K. J. Kennedy, and G. D. Sprott.
1991.
A generally applicable technique for the extraction of restrictable DNA from methanogenic bacteria.
J. Microbiol. Methods
14:119-126[CrossRef].
|
| 29.
|
Muirhead, H.,
D. A. Clayden,
D. Barford,
C. G. Lorimer,
L. A. Fothergill-Gilmore,
E. Schiltz, and W. Schmitt.
1986.
The structure of cat muscle pyruvate kinase.
EMBO J.
5:475-481[Medline].
|
| 30.
|
Nairn, J.,
D. Duncan,
L. M. Gray,
G. Urquhart,
M. Binnie,
O. Byron,
L. A. Fothergill-Gilmore, and N. C. Price.
1998.
Purification and characterization of pyruvate kinase from Schizosaccharomyces pombe: evidence for an unusual quaternary structure.
Protein Exp. Purif.
14:247-253[CrossRef][Medline].
|
| 31.
|
Nairn, J.,
S. Smith,
P. J. Allison,
D. Rigden,
L. A. Fothergill-Gilmore, and N. C. Price.
1995.
Cloning and sequencing of a gene encoding pyruvate kinase from Schizosaccharomyces pombe: implications for quaternary structure and regulation of the enzyme.
FEMS Microbiol. Lett.
134:221-226[CrossRef][Medline].
|
| 32.
|
Pawluk, A.,
R. K. Scopes, and K. Griffiths-Smith.
1986.
Isolation and properties of the glycolytic enzymes from Zymomonas mobilis. The five enzymes from glyceraldehyde-3-phosphate dehydrogenase through to pyruvate kinase.
Biochem. J.
238:275-281[Medline].
|
| 33.
|
Philippe, H.
1993.
MUST, a computer package of management utilities for sequences and trees.
Nucleic Acids Res.
21:5264-5272[Abstract/Free Full Text].
|
| 34.
|
Potter, S., and L. A. Fothergill-Gilmore.
1992.
Purification and properties of pyruvate kinase from Thermoplasma acidophilum.
FEMS Microbiol. Lett.
94:235-240[CrossRef].
|
| 35.
|
Saitou, N., and M. Nei.
1987.
The neighbor-joining method: a new method for reconstructing phylogenetic trees.
Mol. Biol. Evol.
4:406-425[Abstract].
|
| 36.
|
Sambrook, J.,
E. F. Fritsch, and T. Maniatis.
1989.
Molecular cloning: a laboratory manual, 2nd ed.
Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.
|
| 37.
|
Selig, M.,
K. B. Xavier,
H. Santos, and P. Schönheit.
1997.
Comparative analysis of Embden-Meyerhof and Entner-Doudoroff glycolytic pathways in hyperthermophilic archaea and the bacterium Thermotoga.
Arch. Microbiol.
167:217-232[Medline].
|
| 38.
|
Siebers, B., and R. Hensel.
1993.
Glucose catabolism of the hyperthermophilic archaeum Thermoproteus tenax.
FEMS Microbiol. Lett.
111:1-8[CrossRef].
|
| 39.
|
Siebers, B.,
H.-P. Klenk, and R. Hensel.
1998.
PPi-dependent phosphofructokinase from Thermoproteus tenax, an archaeal descendant of an ancient line in phosphofructokinase evolution.
J. Bacteriol.
180:2137-2143[Abstract/Free Full Text].
|
| 40.
|
Siebers, B.,
V. F. Wendisch, and R. Hensel.
1997.
Carbohydrate metabolism in Thermoproteus tenax: in vivo utilization of the non-phosphorylative Entner-Doudoroff pathway and characterization of its first enzyme, glucose dehydrogenase.
Arch. Microbiol.
168:120-127[CrossRef][Medline].
|
| 41.
|
Swofford, D. L.
1999.
PAUP*: phylogenetic analysis using parsimony (and other methods), version 4.0.
Sinauer Associates, Sunderland, Mass.
|
| 42.
|
Thompson, J. D.,
D. G. Higgins, and T. J. Gibson.
1994.
CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting, position-specific gap penalties and weight matrix choice.
Nucleic Acids Res.
22:4673-4680[Abstract/Free Full Text].
|
| 43.
|
van der Oost, J.,
G. Schut,
S. W. Kengen,
W. R. Hagen,
M. Thomm, and W. M. de Vos.
1998.
The ferredoxin-dependent conversion of glyceraldehyde-3-phosphate in the hyperthermophilic archaeon Pyrococcus furiosus represents a novel site of glycolytic regulation.
J. Biol. Chem.
273:28149-28154[Abstract/Free Full Text].
|
| 44.
|
Weil, C. F.,
D. S. Cram,
B. A. Sherf, and J. N. Reeve.
1988.
Structure and comparative analysis of the genes encoding components C of methyl coenzyme M reductase in the extremely thermophilic archaebacterium Methanothermus fervidus.
J. Bacteriol.
70:4718-4726.
|
| 45.
|
Zillig, W.,
K. O. Stetter,
W. Schäfer,
D. Janekovic,
S. Wunderl,
I. Holz, and P. Palm.
1981.
Thermoproteales: a novel type of extremely thermophilic anaerobic archaebacteria isolated from Icelandic solfatares.
Zentbl. Bakteriol. Hyg. I Abt. Orig. C
2:205-227.
|
Journal of Bacteriology, April 2000, p. 2001-2009, Vol. 182, No. 7
0021-9193/00/$04.00+0
Copyright © 2000, American Society for Microbiology. All rights reserved.
This article has been cited by other articles:
-
Suzuki, K., Ito, S., Shimizu-Ibuka, A., Sakai, H.
(2008). Crystal Structure of Pyruvate Kinase from Geobacillus stearothermophilus. J Biochem
144: 305-312
[Abstract]
[Full Text]
-
Zaparty, M., Zaigler, A., Stamme, C., Soppa, J., Hensel, R., Siebers, B.
(2008). DNA Microarray Analysis of Central Carbohydrate Metabolism: Glycolytic/Gluconeogenic Carbon Switch in the Hyperthermophilic Crenarchaeum Thermoproteus tenax. J. Bacteriol.
190: 2231-2238
[Abstract]
[Full Text]
-
Andre, C., Froehlich, J. E., Moll, M. R., Benning, C.
(2007). A Heteromeric Plastidic Pyruvate Kinase Complex Involved in Seed Oil Biosynthesis in Arabidopsis. Plant Cell
19: 2006-2022
[Abstract]
[Full Text]
-
Oria-Hernandez, J., Riveros-Rosas, H., Ramirez-Silva, L.
(2006). Dichotomic Phylogenetic Tree of the Pyruvate Kinase Family: K+-DEPENDENT AND -INDEPENDENT ENZYMES. J. Biol. Chem.
281: 30717-30724
[Abstract]
[Full Text]
-
Oria-Hernandez, J., Cabrera, N., Perez-Montfort, R., Ramirez-Silva, L.
(2005). Pyruvate Kinase Revisited: THE ACTIVATING EFFECT OF K+. J. Biol. Chem.
280: 37924-37929
[Abstract]
[Full Text]
-
Siebers, B., Tjaden, B., Michalke, K., Dorr, C., Ahmed, H., Zaparty, M., Gordon, P., Sensen, C. W., Zibat, A., Klenk, H.-P., Schuster, S. C., Hensel, R.
(2004). Reconstruction of the Central Carbohydrate Metabolism of Thermoproteus tenax by Use of Genomic and Biochemical Data. J. Bacteriol.
186: 2179-2194
[Abstract]
[Full Text]
-
Johnsen, U., Hansen, T., Schonheit, P.
(2003). Comparative Analysis of Pyruvate Kinases from the Hyperthermophilic Archaea Archaeoglobus fulgidus, Aeropyrum pernix, and Pyrobaculum aerophilum and the Hyperthermophilic Bacterium Thermotoga maritima: UNUSUAL REGULATORY PROPERTIES IN HYPERTHERMOPHILIC ARCHAEA. J. Biol. Chem.
278: 25417-25427
[Abstract]
[Full Text]
-
Dorr, C., Zaparty, M., Tjaden, B., Brinkmann, H., Siebers, B.
(2003). The Hexokinase of the Hyperthermophile Thermoproteus tenax: ATP-DEPENDENT HEXOKINASES AND ADP-DEPENDENT GLUCOKINASES, TWO ALTERNATIVES FOR GLUCOSE PHOSPHORYLATION IN ARCHAEA. J. Biol. Chem.
278: 18744-18753
[Abstract]
[Full Text]
-
Knowles, V. L., Smith, C. S., Smith, C. R., Plaxton, W. C.
(2001). Structural and Regulatory Properties of Pyruvate Kinase from the Cyanobacterium Synechococcus PCC 6301. J. Biol. Chem.
276: 20966-20972
[Abstract]
[Full Text]
-
Siebers, B., Brinkmann, H., Dorr, C., Tjaden, B., Lilie, H., van der Oost, J., Verhees, C. H.
(2001). Archaeal Fructose-1,6-bisphosphate Aldolases Constitute a New Family of Archaeal Type Class I Aldolase. J. Biol. Chem.
276: 28710-28718
[Abstract]
[Full Text]