Previous Article | Next Article 
Journal of Bacteriology, April 2000, p. 2018-2025, Vol. 182, No. 7
0021-9193/00/$04.00+0
Copyright © 2000, American Society for Microbiology. All rights reserved.
sal Genes Determining the Catabolism of
Salicylate Esters Are Part of a Supraoperonic Cluster of Catabolic
Genes in Acinetobacter sp. Strain ADP1
Rheinallt M.
Jones,
Vassilis
Pagmantidis, and
Peter A.
Williams*
School of Biological Sciences, University of
Wales Bangor, Bangor, Gwynedd LL57 2UW, Wales, United Kingdom
Received 4 October 1999/Accepted 4 January 2000
 |
ABSTRACT |
A 5-kbp region upstream of the are-ben-cat genes was
cloned from Acinetobacter sp. strain ADP1, extending the
supraoperonic cluster of catabolic genes to 30 kbp. Four open reading
frames, salA, salR, salE, and
salD, were identified from the nucleotide sequence. Reverse
transcription-PCR studies suggested that these open reading frames are
organized into two convergent transcription units, salAR
and salDE. The salE gene, encoding a protein of
239 residues, was ligated into expression vector pET5a. Its product, SalE, was shown to have esterase activity against short-chain alkyl
esters of 4-nitrophenol but was also able to hydrolyze ethyl salicylate
to ethanol and salicylic acid. A mutant of ADP1 with a Kmr
cassette introduced into salE had lost the ability to
utilize only ethyl and methyl salicylates of the esters tested as sole carbon sources, and no esterase activity against ethyl salicylate could
be detected in cell extracts. SalE was induced during growth on ethyl
salicylate but not during growth on salicylate itself. salD
encoded a protein of undetermined function with homologies to the
Escherichia coli FadL membrane protein, which is involved in facilitating fatty acid transport, and a number of other proteins detected during aromatic catabolism, which may also function in hydrocarbon transport or uptake processes. A Kmr cassette
insertion in salD deleteriously affected cell growth and
viability. The salA and salR gene products
closely resemble two Pseudomonas proteins, NahG and NahR,
respectively encoding salicylate hydroxylase and the LysR family
regulator of both salicylate and naphthalene catabolism.
salA was cloned into pUC18 together with salR
and salE, and its gene product showed salicylate-inducible hydroxylase activity against a range of substituted salicylates, with
the same relative specific activities as found in wild-type ADP1 grown
on salicylate. Mutations involving insertion of Kmr
cassettes into salA and salR eliminated
expression of salicylate hydroxylase activity and the ability to grow
on either salicylate or ethyl salicylate. Studies of mutants with
disruptions of genes of the
-ketoadipate pathway with or without an
additional salE mutation confirmed that ethyl salicylate
and salicylate were channeled into the
-ketoadipate pathway at the
level of catechol and thence dissimilated by the cat gene
products. SalR appeared to regulate expression of salA but
not salE.
 |
INTRODUCTION |
Acinetobacter sp. strain
ADP1 is capable of utilizing a range of aromatic compounds as sole
sources of carbon. These compounds are dissimilated via the
-ketoadipate pathway either through benzoate and catechol or,
alternatively, through 4-hydroxybenzoate and 3,4-dihydroxybenzoate
(protocatechuate) (15, 22). Although the two branches have
three terminal reactions in common, from
-ketoadipate enol lactone
to the coenzyme A esters of succinate and acetate, each branch has its
own genes and enzymes. The genes for the two branches are located in
two supraoperonic clusters, the ben-cat cluster (7, 8,
20) (GenBank accession no. AF009224 and AF150928) and the
pob-qui-pca cluster (9, 10) (GenBank accession
no. L05770), which both extend for >20 kbp but are separated on the
chromosome by approximately 270 kbp (13). Recently we
reported that at one end of the ben-cat cluster is a group
of four genes, areA, -B, -C, and
-R, encoding an esterase, two dehydrogenases, and a
regulator protein, that are responsible for the catabolism of alkanoate
esters of benzyl alcohol, 2-hydroxybenzyl (salicyl) alcohol, and
4-hydroxybenzyl alcohol to benzoate, salicylate, and 4-hydroxybenzoate,
respectively, and thus feeding these substrates into one of the two
branches of the
-ketoadipate pathway (17). In this paper,
we report a further extension, by about 5 kbp, of the
ben-cat supraoperonic cluster beyond the are
genes to include previously unreported genes responsible for the
catabolism of alkyl salicylates through salicylic acid to catechol and
thus channeling new substrates into the catechol branch of the pathway.
 |
MATERIALS AND METHODS |
Strains and plasmids.
The plasmids and bacterial strains
used in this study are listed in Table 1.
Isolates ADPW1 and ADPW38 were spontaneous mutants selected by the
procedure outlined in reference 31.
Chemicals and media.
Aromatic substrates were obtained from
Sigma-Aldrich Co. Ethyl salicylate was redistilled under reduced
pressure to remove small amounts of contaminating ethanol.
Luria-Bertani (LB) medium (23) was used for the cultivation
of bacteria unless otherwise noted. For growth on defined carbon
sources in liquid medium, the substrates were added to minimal salts
medium (4) at the following concentrations: ethyl
salicylate, sodium salicylate, benzyl acetate, benzoate, and
4-hydroxybenzoate at 2.5 mM and succinate at 10 mM. For growth on solid
medium, a single nonvolatile carbon source (succinate, benzoate,
salicylate, or 4-hydroxybenzoate) was added to minimal agar at the same
concentrations, but volatile compounds (i.e., all of the esters) were
presented in small tubes in the lids of inverted petri dishes
containing minimal medium. When appropriate, ampicillin was
incorporated at 100 µg/ml and kanamycin was added at 50 µg/ml for
Escherichia coli and at 10 µg/ml for
Acinetobacter.
DNA manipulations.
Standard methods were used for DNA
manipulations (23). Total DNA was prepared from
Acinetobacter sp. strain ADP1 by the cetyltrimethylammonium
bromide method (3). Plasmids carrying insertions of
Acinetobacter DNA were isolated from and maintained in
E. coli host strain XL1-Blue MRF' or DH5
(Table 1) unless otherwise noted. Plasmid DNA was prepared from E. coli by
the alkaline lysis miniprep method (23) or by using Qiaprep
columns (Qiagen). DNA fragments were recovered from agarose gels by
using Qiaquick columns (Qiagen). Southern blots were prepared as
described by Sambrook et al. (23), and hybridizations were
carried out with an ECL direct labeling kit (Amersham) in accordance
with the manufacturer's instructions.
PCR amplification.
PCR amplifications were carried out in
50-µl volumes of reaction buffer (New England Biolabs) containing 10 ng of template DNA, 100 pmol of each primer, 2.5 nmol of each
deoxynucleoside triphosphate, 300 nmol of MgSO4, and 1 U of
Vent polymerase (New England Biolabs). In some reactions, 200 nmol of
MgCl2 and 1 U of Taq polymerase were used in
place of the MgSO4 and Vent polymerase. The mixtures were
subjected to a 4-min hot start at 94°C and then to 30 cycles of 1 min
at 94°C, 1 min at 56°C, and 2 min at 74°C.
RT-PCR.
Cells were grown on minimal medium containing either
ethyl salicylate, salicylate, or succinate until they reached a density of about 108/ml. Total RNA was prepared from 10 ml of the
culture by using RNeasy Mini columns (Qiagen), with elution in 50 µl
of water. To remove any contaminating genomic DNA, the RNA was
incubated with 1 U of RNase-free DNase (Promega) and 1 U of RNasin
(Promega) in 40 mM Tris-HCl (pH 7.9) containing 10 mM NaCl (10 mM),
CaCl2 (10 mM), and MgSO4 (6 mM) for 30 min at
37°C. The RNA was cleaned by passage through an RNeasy Mini column
prior to use in reverse transcription (RT)-PCR. RT-PCR was carried out
with an Access RT-PCR kit (Promega). Amplifications were carried out
across the salD-salE and salA-salR intergenic
regions by using primer pair EDf
(5'-AGATTTAGGTATTCAGCAATTCAGGGCAAAAGGTG-3')-EDr
(5'-AAGGCTCAGGCGTAAGCATCTTGTAAGTTTCCTC-3') and ARf
(5'-CCATGGACACGTGCGGTAGAC-3')-ARr
(5'-TTTTTGGTGCATGTGCTCGTAAGT-3'), respectively. PCRs were
carried out in 50-µl volumes of reaction buffer (Promega) containing
0.5 µg of total RNA, 50 pmol of each primer, 50 µM (each)
deoxynucleoside triphosphate, 1 mM MgSO4, 5 U of avian
myeloblastosis virus reverse transcriptase, and 5 U of Tfl
DNA polymerase. After RT at 48°C for 1 h, the reaction mixtures
were heated to 94°C for 2 min and subjected to 40 cycles of 30 s
at 94°C, 1 min at 55°C, and 2 min at 68°C. Negative-control reactions, designed to ensure that residual genomic DNA was not amplified, were performed in the same way, except that the reverse transcriptase was omitted from the reaction mixtures.
Cloning of Acinetobacter sp. strain ADP1 DNA.
DNA adjacent to areABC was isolated by using the chromosomal
drug resistance cassette in areB of strain ADPW57
(17). A plasmid library in E. coli (pUC18) was
made from chromosomal DNA of ADPW57, from which plasmid pADPW32 with an
8.0-kbp SacI insert (Fig. 1) was selected by screening for Kmr Apr colonies.
pADPW34 was constructed as a SacI-to-XbaI
subclone of pADPW32 (Fig. 1) so as to have sequence overlap with the
previously sequenced plasmid pADPW33 (17). pADPW34 was used
as the DNA sequencing template. Sequence alignment confirmed its
overlap with pADPW33.

View larger version (21K):
[in this window]
[in a new window]
|
FIG. 1.
Physical map of the salA, salR,
salE, and salD genes and their location relative
to areABC at the left-hand end (as drawn) of the
supraoperonic ben-cat cluster. The inserts of the plasmids
produced from cloning genomic DNA into vectors are specified in Table
1. pADPW32 was cloned directly from genomic DNA. All other plasmids
were produced by PCR from genomic DNA (denoted by asterisks) or by
subcloning from plasmids containing genomic DNA. Sites at the termini
of the inserts marked with asterisks were incorporated via PCR primers.
The Kmr cassette insertions are not to scale. The
abbreviations for the restriction sites are as follows: Bc,
BclI; C, ClaI; E, EcoRI; H,
HindIII; N, NsiI; Nd, NdeI; S,
SacI; and X, XbaI.
|
|
Expression of salE in E. coli.
Oligonucleotide primers were designed to produce a PCR fragment of the
salE gene with (i) an NdeI site introduced at the
putative start site of the reading frame, (ii) a constructed
EcoRI site upstream of the NdeI site, and (iii)
an EcoRI site downstream of the gene. The PCR fragment
generated from pADPW34 was cut with EcoRI and first ligated
into EcoRI-cut pUC18 to create pADPW49 (Table 1). The insert
was sequenced on one strand to ensure that mutations had not been
incorporated during the PCR. A fragment was excised with
NdeI and EcoRI, religated into the expression vector pET5a, and transformed into E. coli BL21(DE3)pLysS to
produce plasmid pADPW70 (Fig. 1). Since salE contained a
NdeI restriction site from bp 8 to 14, the forward primer
was designed with a mutation in the ninth base pair (A
G) that
destroyed the native NdeI site but did not change the amino
acid encoded (Thr). The primers used were
5'-AGGAGAATTCATATGATAACGTATGTACTTGTTC-3' (forward) and
5'-AGCGAATTCCTCGGATATGGTTGATTCAAAC-3' (reverse) (the NdeI site is italicized, the
EcoRI restriction sites used for cloning into pUC18 are
underlined, and the bases which differ from the wild-type sequence are
in boldface type). The SalE protein encoded on the expression vector
pADPW70 was expressed in E. coli BL21(DE3)pLysS by growth of
the bacterium in LB medium to an optical density at 600 nm of 0.6 and
subsequent induction for 4 h by addition of 0.4 mM
isopropyl-
-D-thiogalactopyranoside (IPTG). Sodium
dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) was
carried out in a discontinuous gel in a Mini-PROTEAN II electrophoresis
cell (Bio-Rad) in accordance with the manufacturer's instructions.
Chromosomal disruption of salA, salR,
salE, and salD in Acinetobacter sp.
strain ADP1.
As a first step in the construction of gene
knockouts, pUC18-derived plasmids carrying part or all of gene
salA, salR, salE, or salD
disrupted by a Kmr cassette were constructed. For
salA, a SacI-HindIII fragment of
pADPW34 was cloned to create pADPW41 (Fig. 1). The Kmr
cassette of pUI1637 (11) was cloned into a unique
ClaI site of pADPW41, creating pADPW44. The salE
gene was disrupted by the insertion of the cassette from pUI1637 into
the unique ClaI site of pADPW49 (see above) to form pADPW76.
Plasmid-borne salR disruption was achieved after first
creating pADPW78, which has a PCR-generated EcoRI insert in
pUC18. This 1.0-kbp fragment, internal to salR and flanking
its ClaI site, was amplified from pADPW34. Primer sequences
(with the EcoRI sites underlined and the altered bases in
boldface) were as follows:
5'-TGGAATTCATGAACAGATCCGAAAAGAACG-3' (forward) and
5'-CATGAATTCCCTGAGTATGCCCGGTA-3'
(reverse). The central ClaI site in the pADPW78 was used as
the insertion site for the Kmr cassette from pUI1637
(11) to create pADPW79. Disruption of plasmid-borne
salD was performed after first creating pADPW82, which has a
PCR-generated EcoRI insert in pUC18. This 1.2-kbp fragment,
flanking the NsiI site in salD, was amplified
from pADPW32. Primer sequences (with the EcoRI sites
underlined and the altered bases in boldface) were as follows:
5'-AGGGGGAATTCTGGCAGCAATCACTG-3' (forward) and
5'-GGGCTGGAATTCCCAAGTACTACCTAT-3' (reverse). The central NsiI site in pADPW82 was used as the insertion
site for a Kmr cassette from pUC4K (28) to
create pADPW86. Plasmids pADPW44, pADPW76, pADPW79, and pADPW86 were
linearized by digestion with an appropriate restriction enzyme, and
each was used to transform ADP1 via natural transformation. Southern
hybridization confirmed that in strains ADPW67
(salA::Kmr), ADPW70
(salE::Kmr), ADPW72
(salR::Kmr), and ADPW78
(salD::Kmr) the altered plasmid-borne
allele had replaced the corresponding chromosomal wild-type region
(data not shown).
Preparation of cell extracts.
Cells were harvested by
centrifugation, washed with 100 mM phosphate buffer (pH 7.4), and
stored as pellets at
20°C. Cell extracts were prepared by
disrupting frozen pellets, suspended in ice-cold 100 mM phosphate
buffer (pH 7.4), with a French pressure cell (SLM Instruments, Inc.,
Urbana, Ill.) and centrifuging the broken cells at 120,000 × g for 30 min at 4°C. The supernatant was stored frozen as
1-ml portions at
20°C.
Transformation of metabolites.
Transformation of ethyl
salicylate into salicylate by cell extracts of SalE was monitored
spectrophotometrically. The measuring cell contained 100 µM
substrate, 100 µM Tris (pH 7.5), and 10 µl of cell extract, while
the reference cell contained only buffer and enzyme.
Enzyme assays.
Salicylate hydroxylase (SalA) activity was
measured in 3-ml reaction mixtures containing 50 mM Tris (pH 7.5), 100 µM NADH, and 100 µM salicylate. The reaction was initiated by
addition of 20 µl of cell extract, and the rate of oxidation of NADH
was determined spectrophotometrically at 340 nm (extinction
coefficient, 6,220 mol
1 cm
1). Salicylate
esterase (SalE) activity was assayed by spectrophotometric monitoring
(405 nm) of the hydrolysis of 4-nitrophenyl ester substrates in 1-ml
reaction mixtures containing 50 mM phosphate buffer (pH 8) and 2 mM
4-nitrophenyl ester. The 4-nitrophenyl esters with an aliphatic moiety
of six or less carbon atoms were dissolved in methanol, and an aliquot
was added to the assay mixture such that the final concentration of the
ester was 2 mM. The 4-nitrophenyl esters with an aliphatic moiety of
eight carbon atoms or longer were first dissolved in 2-propanol at
60°C and then added dropwise to 50 mM Tris-HCl (pH 8.0), prewarmed to
60°C, to a final ester concentration of 2 mM. The assay reactions
were initiated by the addition of 10 µl of enzyme. The molar
extinction coefficient of 4-nitrophenol was taken as 14,800 mol
1 cm
1. The activity of the esterase with
ethyl salicylate as the substrate was determined in a linked assay. The
rate of increase of absorbance at 340 nm was measured in 1-ml reaction
mixtures containing 100 mM phosphate buffer (pH 8), 2 mM
NAD+, 100 µM substrate, and 10 U of yeast alcohol
dehydrogenase (Sigma-Aldrich Co.). The reaction was initiated by the
addition of esterase. A linear response of rate to added esterase
verified that the esterase-catalyzed reaction was the rate-limiting
step. The assay produced 1 mol of NADH per mol of ethyl salicylate utilized.
Determination of kinetic parameters for salicylate esterase.
To obtain Km and maximum velocity
(Vmax) values, initial velocities were measured
at several nonsaturating concentrations of each compound. Preliminary
experiments determined the approximate value of
Km, and accurate rate determinations were then
performed with from 7 to 10 different substrate concentrations spanning the approximate Km value. Initial velocities
were analyzed by direct linear analysis using the program EnzPack,
which calculates the most probable values for the kinetic parameters
with their 68% confidence limits (30). Each reaction
velocity was determined in triplicate with two separate extract
preparations. The concentration of the substrate stock solution was
accurately determined enzymatically by making the substrate limiting in
the assay while other components were in excess, and the change in
absorbance at 405 nm, corresponding to the total conversion of added
substrate, was determined.
Nucleotide sequencing and sequence analysis.
DNA sequences
were determined by primer walking of fragments cloned in pUC18 by
MWG-Biotech Ltd. (Ebersberg, Germany). Searches of the GenBank database
were carried out with the BLASTN and BLASTP programs from the National
Center for Biotechnology Information, Bethesda, Md. (2).
Sequence data were aligned and edited by using the Lasergene software
package (DNAStar, Inc., Madison, Wis.). Amino acid sequence alignments
were performed with the program ClustalW (PAM350 matrix)
(27).
Nucleotide sequence accession number.
The DNA sequence
obtained in this study has been added to the GenBank database
(accession no. AF150928).
 |
RESULTS |
Analysis of nucleotide sequences of protein products.
Analysis
of the nucleotide sequence downstream of areA revealed the
presence of four open reading frames (Table
2). Immediately downstream of
areA, but separated by 195 bp and an inverted repeat, which
could serve as a termination loop for areA expression
(17), is a gene designated here as salD. SalD
shows 13 to 17% amino acid sequence similarity to putative proteins
encoded by other operons of aromatic catabolism in different bacteria,
which include TodX (29), XylN (GenBank accession no.
D63341), and TbuX (H.-Y. Kahng, A. M. Byrne, R. H. Olsen, and
J. J. Kukor, submitted for publication), which have been suggested
to be membrane proteins involved in the transport of hydrocarbons
(J. J. Kukor, personal communication). Downstream of
salD is a gene, which we have called salE, whose
product shows homology to serine esterases of the
/
hydrolase
family of enzymes (21, 26) but which is not closely related
to the benzyl esterase AreA-encoding gene lying upstream of it (26%
similar, 15% identical). Transcribed convergently toward
salE is a gene, which we have called salR,
apparently encoding a regulatory protein of the LysR family. The
closest matches to SalR are two NahR proteins involved in naphthalene
catabolism, one from Pseudomonas stutzeri (6) and
one from the Pseudomonas putida NAH7 plasmid
(25). The latter protein has a dual role as a positive
regulator of two functionally related operons, for the conversion of
naphthalene to salicylate and for the further conversion of salicylate
to central metabolites via catechol and the subsequent extradiol
(meta) cleavage pathway (24, 25, 33). The final
gene in this cluster is salA, whose putative product's
closest relatives have both been named NahG. These enzymes are
salicylate hydroxylases, converting the salicylate produced from
naphthalene to catechol. The genes encoding both enzymes head the
salicylate catabolic operon on the NAH7 plasmid (34) and in
P. stutzeri (6), respectively. However, it has
been noted that ADP1 does not grow on naphthalene as a sole carbon source. The alignments of both salA and salR with
their Pseudomonas homologues strongly indicate that unlike
the Pseudomonas genes, they both have a GTG start codon.
Insertional inactivation of single genes.
The chromosomal
copies of salA, salE, salR, and
salD were specifically disrupted, individually, by the
insertion of a Kmr cassette into each of the genes in
plasmid constructs (pADPW44, pADPW76, pADPW79, and pADPW86,
respectively [Fig. 1]). The disrupted genes were introduced into
ADP1, using the high frequency of natural transformation of which this
strain is capable. Two of the resulting strains, ADPW67
(salA::Kmr) and ADPW72
(salR::Kmr), failed to grow on
salicylate, unlike ADP1, which grows vigorously on salicylate
overnight. By contrast, ADPW70
(salE::Kmr) grew on salicylate as well
as did ADP1. ADPW78 (salD::Kmr) was a
very unhealthy strain; it grew slowly compared with ADP1 even on
succinate minimal medium and rich (LB) medium and lost viability when
maintained on agar after 2 to 3 days. However, despite these
limitations it, too, like ADPW70, grew on salicylate. Because SalE
showed amino acid sequence homologies with other esterases, we compared
the abilities of ADPW70 and ADP1 to grow on a range of esters
containing aromatic components both as the alcohol and as the acid
moiety, as well as a number of exclusively aliphatic esters. Thirteen
esters (n-propyl acetate, benzyl acetate, n-butyl
propionate, ethyl propionate, benzyl propionate, ethyl valerate, ethyl
butyrate, benzyl butyrate, ethyl caproate, ethyl benzoate,
n-propyl benzoate, n-butyl benzoate, and ethyl
benzoylacetate) were growth substrates for both strains, and 6 (ethyl
acetate, n-butyl acetate, n-butyl butyrate,
benzyl benzoate, n-propyl cinnamate, and benzyl salicylate)
were substrates for neither strain. However, ethyl salicylate and
methyl salicylate supported growth of ADP1 but not ADPW70, suggesting
that SalE is a hydrolase specific for these esters. Neither ADPW67,
ADPW72, nor ADPW78 was able to grow on either of the two alkyl salicylates.
Expression of cloned salE.
The salE gene was
cloned into expression vector pET5a as plasmid pADPW70 with its start
codon (ATG) located in the optimal position for expression. SDS-PAGE of
the induced E. coli BL21(DE3)pLysS containing pADPW70
revealed a strong protein band with an expected molecular mass of 27 kDa (Fig. 2). The esterase activity in
extracts of induced cells against a range of 4-nitrophenyl esters was
measured and compared with the activity of the upstream benzyl esterase AreA (17) (Table 3). Whereas
AreA shows a broad specificity for the alkanoate side chain, going up
to C16, SalE shows a much more restricted range, up to only
C6. The Km values of SalE for 4-nitrophenyl acetate and 4-nitrophenyl butyrate were 106 and 77 µM,
respectively, whereas the relative Vmax dropped
10-fold, from 28 to 2.8 µmol/min/mg, for the same two substrates.

View larger version (73K):
[in this window]
[in a new window]
|
FIG. 2.
SDS-PAGE of overexpressed SalE and AreA proteins. The
lanes contain lysates from E. coli BL21(DE3)pLysS carrying
the following plasmids, induced with IPTG (I) or uninduced (U): lane 2, pADPW70 (I); lane 3, pADPW70 (U); lane 4, pADPW40 (I); lane 5, pADPW40
(U); and lane 6, pET5a. Lane 1 contained molecular mass standards (A,
97.4 kDa; B, 66.2 kDa; C, 45.0 kDa; D, 31.0 kDa; and E, 21.5 kDa). The
estimated molecular masses for the overexpressed bands are 27 kDa for
SalE (lane 2) and 37 kDa for AreA (lane 4).
|
|
We attempted to set up a SalE assay using ethyl salicylate as a
substrate by linkage to salicylate hydroxylase SalA overexpressed
from
a pET5a-derived plasmid. Unfortunately, the SalA construct
failed to
show activity for as-yet-undiagnosed reasons. However,
we did set up an
alternative assay with ethyl salicylate as a
substrate by linking the
assay to yeast alcohol dehydrogenase,
acting on the ethanol produced by
SalE action. This was successfully
carried out and showed that after
IPTG induction the
E. coli(pADPW70)
exhibited high-level
hydrolytic activity against ethyl salicylate
(Table
4).
Expression of salicylate hydroxylase.
Using the standard
NADH-linked assay procedure, we were able to detect salicylate
hydroxylase activity in a number of strains (Table
5). For ADP1, activity was not detectable
in succinate-grown cells but was induced by growth on both salicylate
and ethyl salicylate, and when grown on succinate in the presence of
both salicylate and ethyl salicylate the activity was significantly
induced, although at a lower level than in the absence of succinate.
For both ADPW67 (salA::Kmr) and ADPW72
(salR::Kmr), no activity was detected
when the cells were grown on succinate plus salicylate or, for the
latter, succinate in the presence of ethyl salicylate. However, for
ADPW70 (salE::Kmr) there was
high-level induction when grown on salicylate and a low, but
significant, level of induction when grown in the presence of ethyl
salicylate, which it is unable to transform.
View this table:
[in this window]
[in a new window]
|
TABLE 5.
Specific activities of salicylate hydroxylase in crude
extracts of cells grown on different carbon sources
|
|
Although we were unable to measure salicylate hydroxylase activity
encoded by the gene cloned into expression vector pET5a
(see above),
activity was detected in
E. coli DH5

(pADPW34), which
carries
salA,
salR, and
salE (Fig.
1).
Moreover, the activity
was induced only when 2 mM salicylate was added
to the LB medium.
The specific activity was twofold higher in
salicylate-induced
E. coli(pADPW34) than in salicylate-grown
ADP1. The relative activities
exhibited by the strain with this cloned
gene against a range
of substituted salicylates were compared with
those expressed
in the wild-type ADP1 and found to be identical, within
experimental
error, with a broad substrate specificity except against
the only
available position 3-substituted salicylate (Table
6).
Phenotypes of mutants.
To demonstrate that the aromatic moiety
arising from salicylate and ethyl salicylate is channeled down the
-ketoadipate pathway, we checked the phenotypes of mutants blocked
both in the sal genes and at three different points in the
-ketoadipate pathway (Table 7). The
three
-ketoadipate pathway mutants were ADP6 (pcaG), which does not grow on 4-hydroxybenzoate or any substrate that feeds
into the protocatechuate branch of the pathway; ADPW1
(catA), with a functionless catechol 1,2-dioxygenase which
blocks the utilization of benzoate and catechol and which accumulates
catechol as demonstrated by the brown coloration on agar plates from
any substrate that feeds into the catechol branch; and ADPW38
(ben), which has an uncharacterized lesion in
benABC and is unable to convert benzoate to
catechol. The Kmr cassette insertion mutation in
salE was also individually introduced into ADP6, ADPW1, and
ADPW38 by natural transformation to produce double mutants, all of
which were tested for growth on the appropriate carbon sources (Table
7). Only ADPW1 of the single
-ketoadipate pathway mutants failed to
grow on salicylate or ethyl salicylate, with catechol accumulating in
both media. The growth phenotypes of the double mutants were consistent
with the proposed pathway (Fig. 3) in
which the salicylate nucleus is fed into the benzoate branch at the
level of catechol.

View larger version (16K):
[in this window]
[in a new window]
|
FIG. 3.
Proposed pathway for the catabolism of alkyl salicylates
linked to the ben-cat branch of the -ketoadipate pathway
in Acinetobacter sp. strain ADP1.
|
|
RT-PCR analysis of ADP1 transcripts.
To confirm that the
sal genes are transcribed during both ethyl salicylate and
salicylate catabolism and that the operon structure is as implied by
the gene organization (Fig. 1), transcripts from cells grown on both of
these substrates and on succinate as a noninducing negative control
were examined. Two primer sets, spanning from salD through
to salE and from salA through to salR,
were constructed (Fig. 4A). The expected
RT-PCR product sizes for the salD-salE and
salA-salR amplicons were 1,195 and 988 bp, respectively. The
PCR products obtained, together with restriction digests chosen to
confirm the presence of expected restriction sites, were analyzed by
agarose gel electrophoresis. The salAR products obtained
from the total RNA of cells grown on both ethyl salicylate and
salicylate were of the expected sizes (Fig. 4B). Also, a
salED product of the expected size was obtained from the
total RNA of cells grown on ethyl salicylate. The presence of
restriction sites in the expected positions within the fragments was
confirmed by digestion with ClaI (salED) and
HindIII (salAR). No products were obtained from total RNA of succinate-grown cells or from reaction mixtures from
which the reverse transcriptase had been omitted (data not shown).

View larger version (36K):
[in this window]
[in a new window]
|
FIG. 4.
RT-PCR of sal genes. (A) Positions of the
genes relative to the SacI site (at bp 1), the primers used
for the RT-PCR, and the HindIII and ClaI
restriction sites. (B) Agarose gel electrophoresis of RT-PCR products
amplified from ADP1 grown on ethyl salicylate and salicylate. The sizes
of molecular size markers (in base pairs) in lanes S (HyperLadder I;
Bioline, London, United Kingdom) are indicated on the right. Lanes: 1, salAR, salicylate-grown cells (expected size, 988 bp); 2, salAR, salicylate-grown cells digested with
HindIII (582 and 406 bp); 3, salAR, ethyl
salicylate-grown cells (expected size, 988 bp); 4, salAR,
salicylate-grown cells digested with HindIII (582 and
406 bp); 5, salED, ethyl salicylate-grown cells (expected
size, 1195 bp); 6, salED, ethyl salicylate- grown cells
digested with ClaI (860 and 335 bp). No detectable products
were obtained in control reactions, with each pair of primers, from
which reverse transcriptase had been omitted or in reactions carried
out on succinate-grown cells (data not shown).
|
|
 |
DISCUSSION |
Catabolic role of sal genes and proteins.
The
two enzymes salicylate esterase (SalE) and salicylate hydroxylase
(SalA) reported in this paper are involved in the sequential catabolism
of alkyl salicylates via salicylate to catechol. They represent another
route into the
-ketoadipate pathway for substrates which are likely
to be found as natural products, either directly of plant origin or as
microbial breakdown products of plant compounds. In this study, both
enzymes were expressed from cloned genes, SalE from the expression
vector pET5a, from which it is expressed to a very high specific
activity, and SalA from a pUC18 clone carrying salERA. The
SalA salicylate hydroxylase activity shows the same relative substrate
preferences as does the activity found in wild-type ADP1 grown on
salicylate alone. In addition, insertional salE and
salA knockout mutants, whose construction was facilitated by
the natural transformation of ADP1, show the phenotype expected from
the proposed pathway (Fig. 3). The further catabolism of the aromatic
moiety into the ben-cat branch of the
-ketoadipate pathway at the level of catechol was also confirmed by the fact that
only mutations in catA (for catechol 1,2-dioxygenase), and not those in the ben or the pca genes, eliminated
the ability to utilize either the ester or the free salt of salicylate.
It is interesting that the location of these genes is directly adjacent
to the
areCBA operon, which we have recently described
(
17), whose role is to channel benzyl alkanoates into the

-ketoadipate
pathway by hydrolysis of the esters to benzyl alcohol
and two
sequential dehydrogenase-catalyzed oxidations of benzyl alcohol
to benzoate. The two sets of genes thus appear complementary in
that
the
are genes are responsible for the catabolism of esters
in which the alcohol moiety is aromatic whereas the
sal
genes
encode proteins that function in the catabolism of esters in
which
the acid moiety is
aromatic.
Comparisons of Sal proteins.
Examination of the deduced amino
acid sequence of SalE in the PROSITE database (16) shows
that from residues 68 to 77 (IVLLGHSYGG) it has the signature
characteristic of serine lipases,
[LIV]-x-[LIVFY]-[LIVMST]-G-[HYWV]-S-x-G-[GSTAC], in which the
serine is the active-site nucleophile. Its primary sequence does not
align closely (<26% similarity) with other reported Acinetobacter esterases, one from Acinetobacter
lwoffii RAG-1 (1) and two (a carboxylesterase
[19] and the adjacent benzyl esterase, AreA
[17]) from strain ADP1, all of which are longer and
have their putative active site serines further from the N terminus
than SalE.
The regulator protein SalR is clearly a member of the LysR family of
regulator proteins, with the family signature motif containing
a
helix-turn-helix at residues 17 to 47 (NISKAAEILNLSQPSVTYNLNRLRKHLNNPL)
according to the PROSITE database
(
16). The high degree of similarity
of both SalR and SalA to
the two
Pseudomonas isofunctional proteins,
NahR and NahG,
from the
P. putida NAH7 plasmid (
24,
33) and
P. stutzeri (
6) implies the occurrence of past
intergeneric
exchange of genes by horizontal transfer and yet, within
the context
of conservation of amino acid sequence, an equilibrium of
DNA
composition, in terms of AT/GC ratio, with that of the host.
Whereas
the four
Pseudomonas genes have G+C ratios of
between 60 and 65%,
the
salA and
salR genes have
a composition more characteristic
of the A+T-rich
Acinetobacter genome (Table
2).
The open reading frame
salD appears to encode a member of a
family of proteins of which FadL from
E. coli (
5)
is perhaps
the archetype. A number of these proteins encoded by open
reading
frames within gene clusters associated with aromatic catabolism
have been reported, including TodX (
29), XylN (GenBank
accession
no.
D63341), TbuX (H.-Y. Kahng, A. M. Byrne, R. H. Olsen, and
J. J. Kukor, submitted for publication), and CumH
(
14), but
their function in this context has yet to be
definitively determined.
The overall level of similarity within the
family is low, only
13 to 17%, but there are 23 conserved residues,
which are also
found in SalD (J. J. Kukor, personal
communication). We have created
a mutant of SalD, with a
Km
r insertion, which is unable to grow on ethyl salicylate,
but because
this insertion will exert a polar effect on
salE
expression, this
does not prove that SalD is essential for its
catabolism. However
RT-PCR has shown that
salD and
salE are cotranscribed during growth
on salicylate and ethyl
salicylate, so it is reasonable to assume
that they have related
functions. Definitive proof of this would
be obtained by constructing a
salD deletion mutant without a concomitant
polar effect on
salE, and so far we have been unable to make such
a mutant.
What is clear is that the growth rate of the
salD::Km
r mutant is severely reduced,
even on noninducing substrates, and
its cell viability is also
impaired, with plate cultures of ADPW78
dying after 2 to 3 days,
whereas cultures of ADPW70 with a
salE::Km
r insertion remain as viable
as those of wild-type
ADP1.
Regulation of sal genes.
SalA activity is induced
by growth of ADP1 on salicylate or on ethyl salicylate (Table 5). It is
probable that SalR is the protein that regulates expression of SalA,
since (i) insertion of a Kmr cassette into salR
in strain ADPW72 stops induction of salicylate hydroxylase activity by
salicylate (Table 5); (ii) salicylate hydroxylase is also salicylate
inducible in E. coli from pADPW34, which carries only
salARE (Table 5); and (iii) there are close amino acid
sequence homologies between SalR, SalA, and the Pseudomonas homologues NahR and NahG. A further point of comparison with the Pseudomonas genes is that there is also homology with the
regions upstream of salA identified by Schell
(24) as being the promoter sites at which NahR interacts;
upstream of nahAa is sequence TCA-N6-TGA, and
upstream of nahG is sequence TCA-N3-TGATGA
(24) (GenBank accession no. M11863). The sequence
upstream of salA is TCA-N3-TGATGG. Just
downstream of this there is also a
35 sequence, TAGGCAATT, which has 5 bases that correspond to those of the
35 sequence identified for nahAa, TGGTGTATT (24)
(GenBank accession no. M11863), but the putative
10 region shows no
similarity. A major difference between the sal and
nah genes is that whereas nahR is transcribed
divergently from its adjacent catabolic gene, nahAa,
salA, and salR appear to be cotranscribed as a
single regulatory unit, as shown by the RT-PCR results. This implies
that SalR controls its own expression.
Similarly, RT-PCR suggests that
salD and
salE are
cotranscribed, although there remains a remote possibility, as is also
the
case with
salAR, that the two genes are separately
transcribed
on two overlapping mRNAs. The induction results show that
growth
on ethyl salicylate is necessary for induction of SalE activity
but that salicylate does not act as the inducer (Table
4). It
is also
clear that (i) when
salR is inactivated in ADPW72
(
salR::Km
r), SalE remains inducible by
ethyl salicylate; and (ii) there
are no obvious potential binding sites
upstream of
salD similar
to
nahR promoter sites.
This points to the possibility that the
regulatory mechanism for
salDE differs from that of
salAR and
implies that
there might be an additional regulator gene on the
ADP1 chromosome that
is involved in the induction of
salDE but
is not located in
the immediate vicinity; we have sequenced about
5 kb further upstream
of
salA and found no obvious regulator gene
present. A
further possibility which needs to be tested is that
salD
and -
E are cotranscribed with
areCBA under the
control of
AreR.
 |
ACKNOWLEDGMENTS |
This research was funded by a BBSRC research studentship (to
R.M.J.).
We thank Weiske Pool for technical help.
 |
FOOTNOTES |
*
Corresponding author. Mailing address: School of
Biological Sciences, University of Wales Bangor, Bangor, Gwynedd LL57
2UW, Wales, United Kingdom. Phone: (44) 1248 382363. Fax: (44) 1248 370731. E-mail: P.A.Williams{at}bangor.ac.uk.
 |
REFERENCES |
| 1.
|
Alon, R. N., and D. L. Gutnick.
1993.
Esterase from the oil-degrading Acinetobacter lwoffii RAG-1: sequence analysis and over-expression in Escherichia coli.
FEMS Microbiol. Lett.
112:275-280[CrossRef][Medline].
|
| 2.
|
Altschul, S. F.,
W. Gish,
W. Miller,
E. W. Myers, and D. J. Lipman.
1990.
Basic local alignment search tool.
J. Mol. Biol.
215:403-410[CrossRef][Medline].
|
| 3.
|
Ausubel, F. M.,
R. Brent,
R. E. Kingston,
D. D. Moore,
J. G. Seidman,
J. A. Smith, and K. Struhl (ed.).
1987.
Current protocols in molecular biology.
John Wiley & Sons, Inc., New York, N.Y.
|
| 4.
|
Bauchop, T., and S. R. Elsden.
1960.
The growth of microorganisms in relation to energy supply.
J. Gen. Microbiol.
23:457-469[Abstract/Free Full Text].
|
| 5.
|
Black, P. N.
1991.
Primary sequence of the Escherichia coli fadL gene encoding an outer membrane protein required for long-chain fatty acid transport.
J. Bacteriol.
173:435-442[Abstract/Free Full Text].
|
| 6.
|
Bosch, R.,
E. Garcia Valdes, and E. R. B. Moore.
1999.
Genetic characterization and evolutionary implications of a chromosomally encoded naphthalene-degradation upper pathway from Pseudomonas stutzeri AN10.
Gene
236:149-157[CrossRef][Medline].
|
| 7.
|
Collier, L. S.,
N. N. Nichols, and E. L. Neidle.
1997.
benK encodes a hydrophobic permease-like protein involved in benzoate degradation by Acinetobacter sp. strain ADP1.
J. Bacteriol.
179:5943-5946[Abstract/Free Full Text].
|
| 8.
|
Collier, L. S.,
G. L. Gaines III, and E. L. Neidle.
1998.
Regulation of benzoate degradation in Acinetobacter sp. strain ADP1 by BenM, a LysR-type transcriptional activator.
J. Bacteriol.
180:2493-2501[Abstract/Free Full Text].
|
| 9.
|
Doten, R. C.,
K.-L. Ngai,
D. J. Mitchell, and L. N. Ornston.
1987.
Cloning and genetic organization of the pca gene cluster from Acinetobacter calcoaceticus.
J. Bacteriol.
169:3168-3174[Abstract/Free Full Text].
|
| 10.
|
Elsemore, D. A., and L. N. Ornston.
1994.
The pca-pob supraoperonic cluster of Acinetobacter calcoaceticus contains quiA, the structural gene for quinate-shikimate dehydrogenase.
J. Bacteriol.
176:7659-7666[Abstract/Free Full Text].
|
| 11.
|
Eraso, J. M., and S. Kaplan.
1994.
prrA, a putative response regulator involved in oxygen regulation of photosynthetic gene expression in Rhodobacter sphaeroides.
J. Bacteriol.
176:32-43[Abstract/Free Full Text].
|
| 12.
|
Gerischer, U., and L. N. Ornston.
1995.
Spontaneous mutations in pcaH and -G, structural genes for protocatechuate 3,4-dioxygenase in Acinetobacter calcoaceticus.
J. Bacteriol.
177:1336-1347[Abstract/Free Full Text].
|
| 13.
|
Gralton, E. M.,
A. L. Campbell, and E. L. Neidle.
1997.
Directed introduction of DNA cleavage sites to produce a high-resolution genetic and physical map of the Acinetobacter sp. strain ADP1 (BD413UE) chromosome.
Microbiology
143:1345-1357[Abstract/Free Full Text].
|
| 14.
|
Habe, H.,
K. Kasuga,
H. Nojiri,
H. Yamane, and T. Omori.
1996.
Analysis of cumene (isopropylbenzene) degradation genes from Pseudomonas fluorescens IP01.
Appl. Environ. Microbiol.
62:4471-4477[Abstract].
|
| 15.
|
Harwood, C. S., and R. E. Parales.
1996.
The -ketoadipate pathway and the biology of self-identity.
Annu. Rev. Microbiol.
50:553-590[CrossRef][Medline].
|
| 16.
|
Hofmann, K.,
P. Bucher,
L. Falquet, and A. Bairoch.
1999.
The PROSITE database, its status in 1999.
Nucleic Acids Res.
27:215-219[Abstract/Free Full Text].
|
| 17.
|
Jones, R. M.,
L. S. Collier,
E. L. Neidle, and P. A. Williams.
1999.
areABC genes determine the catabolism of aryl esters in Acinetobacter sp. strain ADP1.
J. Bacteriol.
181:4568-4575[Abstract/Free Full Text].
|
| 18.
|
Juni, E.
1972.
Interspecies transformation of Acinetobacter: genetic evidence for a ubiquitous genus.
J. Bacteriol.
112:917-931[Abstract/Free Full Text].
|
| 19.
|
Kok, R. G.,
V. M. Christoffels,
B. Vosman, and K. J. Hellingwerf.
1993.
Growth-phase dependent expression of the lipolytic system of Acinetobacter calcoaceticus BD413: cloning of a gene encoding one of the esterases.
J. Gen. Microbiol.
139:2329-2342[Abstract/Free Full Text].
|
| 20.
|
Neidle, E. L.,
M. K. Shapiro, and L. N. Ornston.
1987.
Cloning and expression in Escherichia coli of Acinetobacter calcoaceticus genes for benzoate degradation.
J. Bacteriol.
169:5496-5503[Abstract/Free Full Text].
|
| 21.
|
Ollis, D. L.,
E. Cheah,
M. Cygler,
B. Dijkstra,
F. Frolow,
S. M. Franken,
M. Harel,
S. J. Remington,
I. Silman,
J. Schrag,
J. L. Sussman,
K. H. G. Verschueren, and A. Goldman.
1992.
The / hydrolase fold.
Protein Eng.
5:197-211[Abstract/Free Full Text].
|
| 22.
|
Ornston, L. N., and E. L. Neidle.
1991.
Evolution of genes for the -ketoadipate pathway in Acinetobacter calcoaceticus, p. 201-237.
In
K. Towner, E. Bergogne-Berezin, and C. A. Fewson (ed.), The biology of Acinetobacter. Plenum Press, New York, N.Y.
|
| 23.
|
Sambrook, J.,
E. F. Fritsch, and T. Maniatis.
1989.
Molecular cloning: a laboratory manual, 2nd ed.
Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.
|
| 24.
|
Schell, M. A., and E. F. Poser.
1989.
Demonstration, characterization, and mutational analysis of NahR protein binding to nah and sal promoters.
J. Bacteriol.
171:837-846[Abstract/Free Full Text].
|
| 25.
|
Schell, M. A., and M. Sukordhaman.
1989.
Evidence that the transcription activator encoded by the Pseudomonas putida nahR gene is evolutionarily related to the transcription activators encoded by the Rhizobium nodD genes.
J. Bacteriol.
171:1952-1959[Abstract/Free Full Text].
|
| 26.
|
Schrag, J. D., and M. Cygler.
1997.
Lipases and / hydrolase fold.
Methods Enzymol.
284:85-107[Medline].
|
| 27.
|
Thompson, J. D.,
D. G. Higgins, and T. J. Gibson.
1994.
CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weights, position-specific gap penalties and weight matrix choice.
Nucleic Acids Res.
22:4673-4680[Abstract/Free Full Text].
|
| 28.
|
Vieira, J., and J. Messing.
1982.
The pUC plasmids, an M13mp7-derived system for insertion mutagenesis and sequencing with synthetic universal primers.
Gene
19:259-268[CrossRef][Medline].
|
| 29.
|
Wang, Y.,
M. Rawlings,
D. T. Gibson,
D. Labbe,
H. Bergeron,
R. Brousseau, and P. C. Lau.
1995.
Identification of a membrane protein and a truncated LysR-type regulator associated with the toluene degradation pathway in Pseudomonas putida F1.
Mol. Gen. Genet.
246:570-579[CrossRef][Medline].
|
| 30.
|
Williams, P. A., and B. N. Zaba.
1997.
EnzPack for Windows.
Biosoft, Cambridge, United Kingdom.
|
| 31.
|
Williams, P. A., and L. E. Shaw.
1997.
mucK, a gene in Acinetobacter calcoaceticus ADP1 (BD413), encodes the ability to grow on exogenous cis,cis-muconate as the sole carbon source.
J. Bacteriol.
179:5935-5942[Abstract/Free Full Text].
|
| 32.
|
Yanisch-Perron, C.,
J. Vieira, and J. Messing.
1985.
Improved M13 phage cloning vectors and host strains: nucleotide sequences of the M13mp18 and pUC19 vectors.
Gene
33:103-119[CrossRef][Medline].
|
| 33.
|
You, I.-S.,
D. Ghosal, and I. C. Gunsalus.
1988.
Nucleotide sequence of plasmid NAH7 gene nahR and DNA binding of the nahR product.
J. Bacteriol.
170:5409-5415[Abstract/Free Full Text].
|
| 34.
|
You, I.-S.,
D. Ghosal, and I. C. Gunsalus.
1991.
Nucleotide sequence analysis of the Pseudomonas putida PpG7 salicylate hydroxylase gene (nahG) and its 3'-flanking region.
Biochemistry
30:1635-1641[CrossRef][Medline].
|
Journal of Bacteriology, April 2000, p. 2018-2025, Vol. 182, No. 7
0021-9193/00/$04.00+0
Copyright © 2000, American Society for Microbiology. All rights reserved.
This article has been cited by other articles:
-
Camara, B., Bielecki, P., Kaminski, F., dos Santos, V. M., Plumeier, I., Nikodem, P., Pieper, D. H.
(2007). A Gene Cluster Involved in Degradation of Substituted Salicylates via ortho Cleavage in Pseudomonas sp. Strain MT1 Encodes Enzymes Specifically Adapted for Transformation of 4-Methylcatechol and 3-Methylmuconate. J. Bacteriol.
189: 1664-1674
[Abstract]
[Full Text]
-
Gao, X., Tan, C. L., Yeo, C. C., Poh, C. L.
(2005). Molecular and Biochemical Characterization of the xlnD-Encoded 3-Hydroxybenzoate 6-Hydroxylase Involved in the Degradation of 2,5-Xylenol via the Gentisate Pathway in Pseudomonas alcaligenes NCIMB 9867. J. Bacteriol.
187: 7696-7702
[Abstract]
[Full Text]
-
Barbe, V., Vallenet, D., Fonknechten, N., Kreimeyer, A., Oztas, S., Labarre, L., Cruveiller, S., Robert, C., Duprat, S., Wincker, P., Ornston, L. N., Weissenbach, J., Marliere, P., Cohen, G. N., Medigue, C.
(2004). Unique features revealed by the genome sequence of Acinetobacter sp. ADP1, a versatile and naturally transformation competent bacterium. Nucleic Acids Res
32: 5766-5779
[Abstract]
[Full Text]
-
Tropel, D., van der Meer, J. R.
(2004). Bacterial Transcriptional Regulators for Degradation Pathways of Aromatic Compounds. Microbiol. Mol. Biol. Rev.
68: 474-500
[Abstract]
[Full Text]
-
Parke, D., Ornston, L. N.
(2004). Toxicity Caused by Hydroxycinnamoyl-Coenzyme A Thioester Accumulation in Mutants of Acinetobacter sp. Strain ADP1. Appl. Environ. Microbiol.
70: 2974-2983
[Abstract]
[Full Text]
-
Nikaido, H.
(2003). Molecular Basis of Bacterial Outer Membrane Permeability Revisited. Microbiol. Mol. Biol. Rev.
67: 593-656
[Abstract]
[Full Text]
-
Jones, R. M., Britt-Compton, B., Williams, P. A.
(2003). The Naphthalene Catabolic (nag) Genes of Ralstonia sp. Strain U2 Are an Operon That Is Regulated by NagR, a LysR-Type Transcriptional Regulator. J. Bacteriol.
185: 5847-5853
[Abstract]
[Full Text]
-
Smith, M. A., Weaver, V. B., Young, D. M., Ornston, L. N.
(2003). Genes for Chlorogenate and Hydroxycinnamate Catabolism (hca) Are Linked to Functionally Related Genes in the dca-pca-qui-pob-hca Chromosomal Cluster of Acinetobacter sp. Strain ADP1. Appl. Environ. Microbiol.
69: 524-532
[Abstract]
[Full Text]
-
Valkova, N., Lepine, F., Bollet, C., Dupont, M., Villemur, R.
(2002). prbA, a Gene Coding for an Esterase Hydrolyzing Parabens in Enterobacter cloacae and Enterobacter gergoviae Strains. J. Bacteriol.
184: 5011-5017
[Abstract]
[Full Text]
-
Clark, T. J., Momany, C., Neidle, E. L.
(2002). The benPK operon, proposed to play a role in transport, is part of a regulon for benzoate catabolism in Acinetobacter sp. strain ADP1. Microbiology
148: 1213-1223
[Abstract]
[Full Text]
-
Diaz, E., Ferrandez, A., Prieto, M. A., Garcia, J. L.
(2001). Biodegradation of Aromatic Compounds by Escherichia coli. Microbiol. Mol. Biol. Rev.
65: 523-569
[Abstract]
[Full Text]
-
Jones, R. M., Williams, P. A.
(2001). areCBA Is an Operon in Acinetobacter sp. Strain ADP1 and Is Controlled by AreR, a {sigma}54-Dependent Regulator. J. Bacteriol.
183: 405-409
[Abstract]
[Full Text]