Previous Article | Next Article 
Journal of Bacteriology, August 2001, p. 4727-4736, Vol. 183, No. 16
0021-9193/01/$04.00+0 DOI: 10.1128/JB.183.16.4727-4736.2001
Copyright © 2001, American Society for Microbiology. All rights reserved.
matB, a Common Fimbrillin Gene of
Escherichia coli, Expressed in a Genetically Conserved,
Virulent Clonal Group
Riitta
Pouttu,1
Benita
Westerlund-Wikström,1
Hannu
Lång,1
Krista
Alsti,1
Ritva
Virkola,1
Ulla
Saarela,1
Anja
Siitonen,2
Nisse
Kalkkinen,3 and
Timo K.
Korhonen1,*
Division of General Microbiology, Department of
Biosciences,1 and Institute of
Biotechnology,3 FIN-00014 University of
Helsinki, and National Public Health Institute (KTL), FIN-00300
Helsinki,2 Finland
Received 27 December 2000/Accepted 30 May 2001
 |
ABSTRACT |
A novel fimbrial type in Escherichia coli was
identified and characterized. The expression of the fimbria was
associated with the O18acK1H7 clonal group of E. coli,
which cause newborn meningitis and septicemia when grown at low
temperature; hence, it was named the Mat (meningitis associated and
temperature regulated) fimbria. The fimbriae were purified from a
fimA::cat sfaA::Gm
fliC::St derivative of the O18K1H7
isolate E. coli IHE 3034. The purified Mat fimbrillin
had an apparent molecular mass of 18 kDa and did not serologically
cross-react with the type 1 or S fimbria of the same strain. The
matB gene encoding the major fimbrillin was cloned from
the genomic DNA of the fimA::cat
sfaA::Gm fliC::St derivative
of IHE 3034. The predicted MatB sequence was of 195 amino acids,
contained a signal sequence of 22 residues, and did not show
significant homology to any of the previously characterized fimbrial
proteins. The DNA sequence of matB was 97.8% identical to a region from nucleotides 17882 to 18469 in the 6- to 8-min region
of the E. coli K-12 chromosome, reported to encode a
hypothetical protein. The 7-kb DNA fragment containing
matB of IHE 3034 was found by restriction mapping and
partial DNA sequencing to be highly similar to the corresponding region
in the K-12 chromosome. Trans complementation of the
matB::cat mutation in the IHE
3034 chromosome showed that matB in combination with
matA or matC restored surface expression
of the Mat fimbria. A total of 27 isolates representing K-12 strains
and the major pathogroups of E. coli were analyzed for
the presence of a matB homolog as well as for expression
of the Mat fimbria. A conserved matB homolog was found in 25 isolates; however, expression of the Mat fimbriae was detected only in the O18acK1H7 isolates. Expression of the Mat fimbria was
temperature regulated, with no or a very small amount of fimbriae or
intracellular MatB fimbrillin being detected in cells cultivated at
37oC. Reverse transcriptase PCR and complementation
assays with mat genes controlled by the inducible
trc promoter indicated that regulation of Mat
fimbria expression involved both transcriptional and
posttranscriptional events.
 |
INTRODUCTION |
Numerous proteinaceous adhesins have
been detected in Escherichia coli (for recent reviews, see
references 20 and 27). These adhesins occur
in the form of fimbrial filaments or are nonfimbrial proteins of the
outer membrane. The adhesins recognize different receptor molecules on
the mammalian epithelia or extracellular matrices and function to
enable colonization of E. coli at specific ecological
niches. Many of the adhesins are associated with E. coli
isolates from specific disease manifestations and contribute to the
establishment of the infections. Examples of such disease-associated adhesins include the P fimbria of uropathogenic E. coli
(UPEC) (55) and the various adhesin types detected in
E. coli pathogroups causing diarrheal diseases (reviewed in
references 13 and 36). Some adhesin genes,
such as those encoding the mannoside-binding type 1 fimbriae
(26) and the fibronectin-binding curli (39), are present on and expressed by a large proportion of natural E. coli isolates. The type 1 fimbriae are important for the spread of
E. coli from one host individual to another (6)
and also enhance bacterial colonization in the human and animal gut and the urinary tract (20, 27). The curli are expressed at low temperature and low osmolarity and may convey a selective advantage for
E. coli in the environment and in the early phases of
intestinal tract colonization (40).
The natural populations of E. coli exhibit extensive genetic
diversity that is organized into a limited number of genetically distinct clonal groups (reviewed in reference 59). Such
widespread, homogenous clonal groups have been well characterized in
E. coli strains from separate outbreaks of disease. The
isolates in the clonal groups are characterized by several identical
phenotypic traits, such as serotype, biotype, phage type, outer
membrane protein profiles, and production of hemolysins, other toxins, specific iron-scavenging systems, and specific adhesins. Multilocus enzyme electrophoresis has shown that isolates in a given clonal group
are genetically conserved (50, 59), and the clonal groups appear sufficiently stable that they have spread into human populations on several continents. Clonal groups in pathogenic E. coli
include several UPEC clones (10, 43, 55), enteropathogenic
E. coli (EPEC), enterohemorrhagic E. coli (EHEC),
enterotoxigenic E. coli (ETEC), and enteroaggregative
E. coli (EAEC) clones (reviewed in references
13 and 35). The association of specific
adhesins with these pathogroups has resulted from horizontal gene
transfer of plasmid genes or chromosomal pathogenicity islands from
other pathogens. On the other hand, diversification of adhesin alleles may result from within-host evolution of E. coli, in which
random point mutations affect the tissue tropism of the bacterium
(52).
The O18acK1H7 isolates represent the major clonal group of E. coli associated with newborn meningitis and septicemia (MENEC) (1, 31, 51). Electrophoretic analysis of chromosomally encoded enzymes revealed that the O18acK1H7 MENEC isolates are genetically highly conserved and form a distinct clone, which is
phenotypically characterized by expression of the S and the type 1 fimbriae and a conserved outer membrane protein profile, as well as, on
the other hand, by lack of the P and the type 1C fimbriae and hemolysin
(1, 31, 51). In this report, we describe a novel fimbrial
gene that is common in E. coli isolates, including
laboratory K-12 strains, but is expressed only in O18acK1H7 MENEC.
 |
MATERIALS AND METHODS |
Bacteria, growth conditions, and plasmids.
The bacterial
strains and plasmids used in this work are listed in Table
1. For expression studies, the bacteria
were cultivated in static Luria broth at 20 or 37°C and under shaking
at 37°C for other purposes. Antibiotics, when necessary, were added
at concentrations of 100 (ampicillin), 25 (chloramphenicol), 30 (gentamicin [Gm]), 75 (rifampin [Rif]), 100 (streptomycin [Sm]
and streptothricin [St]), or 12.5 (tetracycline) µg
ml
1. The antibiotics were obtained from Sigma
Chemical Co, St Louis, Mo., except for streptomycin and streptothricin,
which were a gift from Helmuth Tschäpe, Robert Koch Institute,
Wernigerode, Germany. Induction of mat genes in recombinant
E. coli strains was done with 5 µM
isopropyl-
-D-thiogalactopyranoside (IPTG) (Promega Corporation, Madison, Wis.).
The influence of growth conditions on expression of Mat fimbria was
tested by cultivating the bacteria in static Luria broth
at 20 or
37°C, as well as at 37°C in a 5% (vol/vol)
CO
2 atmosphere,
under anaerobic conditions, in
the presence of 0.2% (wt/vol)
D-glucose,
with a low
(0.1%) or high (2%) concentration of NaCl, in the presence
of 0.2 mM
iron chelator 2,2-dipyridyl (Sigma Chemical Co.), or
in the presence of
10% (vol/vol) human whole blood. The bacteria
were passaged three
times under these conditions before they were
tested for Mat fimbria
expression.
DNA techniques.
Isolation of plasmid and chromosomal DNA
from E. coli cells and DNA manipulations were performed by
routine procedures (47). Restriction enzymes (Promega
Corp., Madison, Wis., and New England Biolabs, Beverly, Mass.) were
used according to the manufacturers' instructions. Cloning of IHE
3034-79 chromosomal DNA into cosmid pHC79 was done according to the
manufacturer's instructions (DNA-Packaging kit; Boehringer Mannheim,
Mannheim, Germany), resulting in the plasmid pMAT1. A 7-kb
EcoRI fragment of pMAT1 that reacted in Southern
hybridization (47) with the degenerate oligonucleotides designed on the basis of the peptide sequences obtained from MatB was
subcloned into pACYC184 to give pMAT2. The DNA sequences of the
degenerate oligonucleotides used in the hybridization were 5'
GCIGAIGTIACIGCICAIGCIGTIGCIACITGG 3' and 5'
TTIGAIGTIGCIATIGAIGGIGAI 3'. The nucleotide sequence of the DNA
region encoding matA and matB in pMAT2 was
determined by using a commercially available sequencing service
(MedProbe AS, Oslo, Norway). The matB gene in the chromosome
of clinical E. coli isolates was detected by PCR with
primers designed on the basis of the sequence of the matB
homolog of MG1655 (5) and DyNAzyme II DNA-polymerase
(Finnzymes, Espoo, Finland) according to manufacturer's instructions.
The obtained PCR products were analyzed by Southern hybridization with
matB gene of E. coli IHE 3034 as a probe by using
the ECL enhanced chemiluminescence direct nucleic acid labeling and
detection system (Amersham Pharmacia Biotech, Amersham Place, Little
Chalfont, Buckinghamshire, England) according to the manufacturer's instructions.
For expression, DNA fragments representing different regions of the
mat gene cluster were amplified by PCR with
Pfu
polymerase
(Stratagene, La Jolla, Calif.), pMAT2 as a template, and
primers
designed on the basis of the DNA sequence of the
mat
region in
E. coli MG1655 (
5). The forward
primer contained an
EcoRI restriction
site, and the reverse
primer contained a
SalI restriction site
at the 5' end. The
amplified DNA fragments were cloned into the
EcoRI-
SalI-site of pSE380 and used in the
complementation
assays.
For reverse transcriptase PCR (RT-PCR), total RNA from
E. coli strains IHE 3034, IHE 3034-90, and MG1665 was extracted with
Qiagen Rneasy kit, following the manufacturer's guidelines. The
enhanced avian RT-PCR kit (Sigma) and a PTC-200 Peltier thermal
cycler
(MJ Research) were used to amplify mRNA by the two-step
method
according to the manufacturer's instructions. The same
amounts of
template RNA were used for comparing the
mat transcripts;
the amounts varied from 0.5 to 2.0 µg in different experiments.
Specific primers corresponded to the following nucleotides of
the
E. coli MG1665 sequence available in GenBank (accession no.
U73857):
matA forward, 19117 to 19134;
matA
reverse, 18547
to 18569;
matB forward, 18449 to 18469;
matB reverse, 17882 to
18002;
matC forward, 17807 to 17824;
matC reverse, 17156 to 17176.
Amplimers were
separated by electrophoresis in a 1% agarose gel
and stained with
ethidium bromide; their relative amounts were
evaluated from the gels
by using the Tina (version 2.0) image
analysis program (Raytest
Isotopenmessgeräte Gmbh, Straubenhardt,
Germany).
A
fimA sfaA fliC triple mutant of IHE 3034, named IHE
3034-79, was constructed by inserting the
sat gene encoding
streptothricin
acetyltransferase from pIE934 (
54) into the
NcoI site within
the
cat gene in a
fliC::
cat fusion (
58)
cloned to the suicide
plasmid pGP704 (
34). The resulting
plasmid was used to silence
the
fliC gene of the
fimA::
cat sfaA::Gm derivative
IHE 3034-59
(
45) by allelic replacement essentially as
described in reference
58. A MatB-null variant of IHE3034,
named
E. coli IHE 3034-90,
was constructed by inserting a
cat cassette encoding chloramphenicol
acetyltransferase from
pMMS1 (
58) into the
Bsu36I site in
matB by the same methodology described above. The correct
genotypes
of IHE 3034-79 and IHE 3034-90 were confirmed by Southern
hybridization
with
fliC and
sat as DNA probes for
IHE 3034-79 and
matB and
cat for IHE 3034-90.
The correct phenotypes of IHE 3034-79 and IHE
3034-90 were confirmed
by agglutination in an antiserum against
H7 flagella available from
previous work (
58) or in an antiserum
against the
Mat-fimbriae obtained in this study as well as by
immunoelectron
microscopy
(IEM).
Sequence comparisons.
Homology searches in the databases
were performed with the BLAST (available at
http://www.expasy.ch/sprot/sprot-top.html) and FASTA
(http://www.ebi.ac.uk/fasta3/) package programs. Comparison of MatB
with other fimbrillins was done by using Align for global alignment
(http: //molbiol.soton.ac.uk/compute/align.html)
and SIM for local alignment
(http://www.expasy.ch/tools/sim-prot.html). Prediction of the presence of stem-loop structures and signal sequences
in the mat genes of MG1655 and IHE 3034 was done by using
programs available at
http://www.fruitfly.org/seq_tools/promoter.html, http://www.genebee.msu.su/services/rna2_reduced.html, and
http://www.cbs.dtu.dk/services/SignalP/. DNA-binding motifs were
identified by using the ProfileScan program at
http://www.isrec.isb-sib.ch/.
Protein chemical methods.
Mat fimbriae were purified from
E. coli IHE 3034-79 and E. coli LE392(pMAT1) by
using deoxycholate and concentrated urea (29). Prior to
sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE)
(47), the type 1 and Mat fimbriae were denaturated at low
pH (33).
Protein and peptide sequencing was performed with an Applied Biosystems
494A Procise sequencer. For analysis the protein was,
after SDS-PAGE,
electroblotted onto a ProBlott (Applied Biosystems,
Perkin-Elmer,
Foster City, Calif.) membrane. For internal sequencing,
the protein was
digested with trypsin, the peptides generated
were separated by
reverse-phase chromatography, and a selected
peptide was subjected to
analysis (
61).
Immunological methods.
The anti-type 1 fimbria and anti-Mat
fimbria sera were obtained by immunizing rabbits according to standard
procedures with the type 1 fimbriae purified from E. coli
IHE 3034-8 and the Mat fimbriae purified from E. coli IHE
3034-79 and E. coli LE392(pMAT1) used as antigens. The
rabbit antiserum raised against the S fimbriae of IHE 3034 was
available from previous work (56). Polyclonal anti-Mat,
anti-type 1, and anti-S fimbria sera were titrated against the purified
type 1, S, and Mat fimbriae by enzyme-linked immunosorbent assay
(ELISA) as described previously (30) with alkaline
phosphatase-conjugated swine anti-rabbit immunoglobulins (Dako A/S,
Denmark; diluted to 1:500) as secondary antibodies and phosphatase
substrate (Sigma Diagnostics, Inc., St. Louis, Mo.) at a concentration
of 1 mg/ml in diethanolamine-magnesium chloride buffer (OY Reagena AB,
Kuopio, Finland). Results were recorded with a Multiscan MS ELISA
reader (Labsystems OY, Helsinki, Finland). Western blotting of
SDS-PAGE-separated fimbrial proteins with anti-Mat fimbria antibodies
was done by routine procedures as described in reference
11.
Mat fimbria expression on
E. coli strains was detected by
indirect immunofluorescence according to the procedure described
in
reference
42. Briefly, the bacteria were immobilized on
glass
slides, fixed with 3.5% (wt/vol) paraformaldehyde in
phosphate-buffered
saline (PBS), and stained with anti-Mat fimbria
antibodies diluted
1:50 and with fluorescein isothiocyanate
(FITC)-labeled swine
anti-rabbit immunoglobulins (Dako A/S) diluted to
1:50. Stained
bacteria were mounted in nicetamid and examined in
an Olympus
BX50 fluorescence microscope (Olympus Optical Co., Hamburg,
Germany)
equipped with epi-illumination and interference filters for
FITC.
For detection of Mat fimbria expression by whole-cell ELISA as
described in reference
8, the bacteria were immobilized
onto
ELISA plates (Nunc A/S, Roskilde, Denmark) for 16 h at
37°C, washed,
and left to react with anti-Mat antibodies diluted from
10
2 to 10
7, and the
amount of bound antibodies was measured by ELISA as
described
above.
Electron microscopy.
For electron microscopy, the bacteria
were suspended in Luria broth and immobilized on copper grids coated
with Pioloform and carbon. For negative staining, the bacteria were
stained with 1% (wt/vol) potassium tungstate (pH 6.5) for 1 min. For
IEM, the bacteria were left to react with anti-Mat antibodies diluted
to 1:500 in PBS and 10-nm-particle-diameter gold-labeled protein A
(Amersham Life Science) diluted to 1:40 and negatively stained as
described above. The grids were examined in a JEOL JEM-1200EX transmission electron microscope at an operation voltage of 60 kV. The
micrographs were taken at the Section of Electron Microscopy, Institute
of Biotechnology, University of Helsinki.
Hemagglutination assays.
Treatment of human
O1 erythrocytes with endo-
-galactosidase,
neuraminidase, trypsin, and pronase and agglutination of the erythrocytes by E. coli 3034-79 were performed by routine
procedures (28).
Nucleotide sequence accession number.
The nucleotide
sequence of the 6- to 8-min region of the E. coli MG1655
chromosome (5) is available at GenBank under accession no.
U73857, and the sequence of the matAB region of the E. coli IHE 3034 chromosome is available under accession no.
AF325731. Identity comparisons were performed with predicted protein
sequences of matB and the following adhesin genes of
E. coli: MG1655 fimA (9), GenBank
accession no. AAC77270; PC31 fimA (25), GenBank
accession no.X00981; IHE 3034 sfaA (15),
GenBank accession no. S53211; J96 papA (3),
GenBank accession no. X03391, K01176, X03392, X61239, and S45610; F17
a-A (32), GenBank accession no. AF022140, M36649, and
M62503; MG1655 ppdD, GenBank accession no. AE000119 and
U00096; K-12 csgA (40), GenBank accession no.
L04979; C921b-1 cooA (44), GenBank accession
no. M58550 and M37148; cooB, GenBank accession no. X62495;
and LMC10 cooC and cooD (14),
GenBank accession no.X76908.
 |
RESULTS |
Purification and characterization of fimbriae from the fimA
sfaA fliC mutant derivative of E. coli IHE
3034.
The O18acK1H7 meningitis isolate E. coli IHE 3034 and the S- and type 1-fimbria-negative double mutant IHE 3034-59 have
been described earlier (15, 30, 31, 45, 51). In order to obtain a derivative that is devoid of all surface filaments, the H7
flagellin gene fliC of IHE 3034-59 was inactivated by
allelic exchange with fliC::cat::sat.
The sat cassette was positioned within the cat
DNA because it contained a suitable NcoI restriction site.
Transconjugants with the correct antibiotic markers were assessed for
flagellation by agglutination in anti-H7 antiserum, and a nonflagellate
mutant was isolated and named IHE 3034-79. The correct genotype of IHE
3034-79 was confirmed by Southern hybridization of
PvuI-digested chromosomal DNA by using fliC and the sat cassette as probes (data not shown). Transmission
electron microscopy of IHE 3034-79 cells cultivated at 20°C revealed
a lack of flagella, but, unexpectedly, showed the presence of fimbrial filaments on the bacteria (Fig. 1A). The
strain IHE 3034-79 was not agglutinated in antisera raised against the
type 1 or S fimbriae from the same strain, indicating that the strain
expressed a third fimbrial type. This fimbria had a diameter of 5 to 7 nm and was 0.4 to 5 µm in length. Because the expression of this
fimbrial type was found to be associated with the major clonal group of MENEC as well as with low temperature (see below), we named it the Mat
(meningitis associated and temperature regulated) fimbria.

View larger version (162K):
[in this window]
[in a new window]
|
FIG. 1.
Electron microscopy of Mat fimbriae. (A) Negatively
stained cells of the fimA sfaA fliC mutant strain
E. coli IHE 3034-79 cultivated at 20°C. (B to D) IEM
of fimbriae from XL1 Blue MRF' harboring pMAT3 (B), pMAT9 (C), or pMAT5
(D). Size bars, 100 nm.
|
|
Mat fimbrial filaments were purified from strain IHE 3034-79 by using
deoxycholate and concentrated urea. An SDS-PAGE analysis
of the
purified Mat fimbriae showed a major peptide with an apparent
molecular
mass of 18 kDa (Fig.
2A). The apparent
molecular size
of the Mat fimbrillin was larger than the apparent sizes
of the
FimA fimbrillin and the SfaA fimbrillin of the same strain
(
30,
45), which are also shown in Fig.
2A.

View larger version (26K):
[in this window]
[in a new window]
|
FIG. 2.
SDS-PAGE (A) and Western blotting (B) of the S fimbria
(lane 1), the type 1 fimbria (lane 2), and the Mat fimbria (lane 3) of
E. coli IHE 3034. The blotting was done with anti-MAT
fimbria antiserum as primary antibodies. The migration distances of
molecular mass marker proteins (size in kilodaltons) are indicated on
the left.
|
|
Polyclonal antisera against Mat fimbriae purified from
E. coli IHE 3034-79 and
E. coli LE392(pMAT1) (see below)
were raised
in rabbits. In Western blotting, the antibodies detected in
the
Mat fimbria preparation a major peptide with an apparent molecular
mass of 18 kDa as well as a minor peptide with an apparent molecular
mass of 16 kDa (Fig.
2B). The antisera against the Mat fimbriae
did not
recognize the FimA or the SfaA proteins (Fig.
2B). In
accordance, ELISA
analysis of purified fimbriae showed that the
Mat fimbriae did not
react with the anti-S fimbria or anti-type
1 fimbria antisera; neither
were the type 1 or S fimbriae recognized
by the anti-Mat fimbria sera
(Table
2). The reactivities of the
two
anti-Mat fimbriae sera were closely similar.
Amino acid sequencing of the Mat fimbriae gave the N-terminal sequence
ADVTAQAVATWSATAKKDTTSKLVVTPLGSLAFQYAEGIK
and the internal
peptide sequence GLFDVAIEGDSTATAFK.
These sequences do not have
homologs in the FimA or SfaA sequences, nor
did we find any significant
homology in any other fimbrial protein
sequences deposited in
the SWISS-PROT data bank. It was thus concluded
that the Mat fimbria
represents a novel
E. coli fimbrial
type.
Cloning and sequencing of mat genes.
We next
ligated random 40-kb fragments from the genome of 3034-79 into the
cosmid cloning vector pHC79, and transfectants of E. coli
LE392 expressing the Mat fimbria were identified by bacterial
agglutination in anti-Mat fimbria serum and by electron microscopy. A
positive recombinant was isolated, and the cosmid was named pMAT1.
Cosmid pMAT1 was digested with the EcoRI restriction enzyme,
and a 7-kb DNA fragment reacting in Southern hybridization with the
oligonucleotide probes was identified and cloned into pACYC184, to
obtain plasmid pMAT2. Electroporation of pMAT2 into E. coli
LE392 gave a recombinant strain reacting with the anti-Mat-fimbria antibodies (data not shown).
An extensive homology search revealed that the amino acid sequences
obtained from the Mat fimbrillin perfectly matched the
predicted amino
acid sequence of an open reading frame at nucleotides
17882 to 18469 in
the 6- to 8-min region of the
E. coli K-12 chromosome
(
5). This DNA encodes a hypothetical protein of 195 amino
acids,
which was identical to the 57 amino acids sequenced from the Mat
fimbrillin. The region surrounding the
mat homolog at the 6- to
8-min region in the K-12 chromosome encodes six hypothetical
proteins,
which are located on a 6,841-bp DNA fragment (Fig.
3). Restriction
mapping with the enzymes
NcoI, NruI,
PstI,
PvuI,
SacII,
SmaI,
and
SnaBI of the 7-kb
fragment in pMAT2 gave a pattern closely
similar to the one predicted
from the K-12 chromosomal sequence
(details not shown). We named three
of these genes
matA, matB,
and
matC, because they
appeared to affect the synthesis of Mat
fimbriae (see below);
matB encodes the Mat fimbrillin homolog
(Fig.
3). The DNA
sequence containing the
matA and
matB genes
of
IHE 3034 was determined and compared to the corresponding region
in the
DNA sequence of MG1655. DNA sequence identity was 93.0%
in the 156-bp
region upstream of
matA, 97.0% within
matA,
93.2%
in the 74-bp intergenic region separating
matA and
matB, 97.8%
within
matB, and 98.2% in the 57-bp
intergenic region between
matB and
matC. The
mat nucleotide sequences are available from
the GenBank
database under accession no.
AF325731.

View larger version (15K):
[in this window]
[in a new window]
|
FIG. 3.
Gene organization of the 6.8-kb fragment containing
mat at the 6- to 8-min region in the chromosome of
E. coli MG1665 (5). The nucleotide numbers
refer to the gene location in the sequence available in GenBank
(accession no. U73857). Arrows below the sequence indicate DNA
fragments cloned into pSE380 and tested for in trans
complementation of the
matB::cat mutation in the
chromosome of E. coli IHE 3034-90 as well as for
expression in E. coli XL1 Blue MRF' (on the right).
|
|
The predicted amino acid sequence of MatB of IHE 3034 is shown in Fig.
4; it contains a 22-amino-acid signal
sequence and
differs from the predicted sequence of the MatB homolog of
E. coli MG1655 only at the position

6, which is within the
signal
sequence. The calculated molecular mass of mature MatB is 17,853
Da. The predicted MatB sequence of 195 amino acids exhibits 19
to 25%
identity with the FimA, SfaA, PapA, F17A, PpdD, CooA, and
CsgA
fimbrillin sequences, with no areas of significant local
identity. The
MatB sequence lacks typical motifs identified in
E. coli
fimbrillins. The C terminus of MatB lacks the

-zipper
motif
recognized by fimbrial chaperones (
21), and its signal
sequence and N terminus are not related to those in the type IV
fimbrillins (
53). MatB also lacks cysteine residues and
hence
disulfide bonds. The predicted MatA sequence is of 196 amino
acids,
lacks a detectable signal sequence, and contains at residues 145
to 195 a predicted helix-turn-helix DNA-binding motif similar
to
the consensus pattern in the LuxR family of regulatory proteins
(
17).

View larger version (16K):
[in this window]
[in a new window]
|
FIG. 4.
Predicted amino acid sequence of MatB of E.
coli IHE 3034. The sequence has a 22-mer signal sequence. No. 1 indicates the N-terminal amino acid residue of the mature protein. The
predicted amino acid sequence from E. coli MG1665
(5) contains methionine at the position 6.
|
|
Mutagenesis, complementation, and expression of
matB.
We next inactivated the matB gene
of E. coli IHE 3034 by allelic exchange with a
matB::cat fusion. A transconjugant with the correct antibiotic markers as well as genotype was isolated and named
IHE 3034-90. The correct genotype of IHE 3034-90 was confirmed by
Southern hybridization of BamHI-SacII-digested
DNA by using matB and the cat cassette as probes
(data not shown). The strain IHE 3034-90 did not express Mat fimbriae,
as analyzed by agglutination in anti-Mat fimbriae antisera, as well as
by IEM (data not shown) and whole-cell ELISA with anti-Mat fimbria
antibodies (Fig. 5A).

View larger version (33K):
[in this window]
[in a new window]
|
FIG. 5.
Expression of Mat fimbriae in E.
coli, as analyzed by whole-cell ELISA with anti-Mat fimbriae as
primary antibodies. (A and C) Expression in cells grown at 20°C. (B
and D) Expression in cells grown at 37°C. (A and B) Expression is
shown for the wild-type IHE 3034, the spontaneous
streptomycin-resistant strain IHE 3034-Sm, the
fimA::cat derivative IHE
3034-2, the sfaA::Gm derivative IHE 3034-8,
the fimA::cat
sfaA::Gm double mutant IHE 3034-59, the
fimA::cat sfaA::Gm
fliC::St triple mutant IHE 3034-79, and the
matB::cat derivative IHE
3034-90. (C and D) Complementation of the
matB::cat mutation in IHE
3034-90 by the pMAT-plasmids encoding regions of the putative
mat gene cluster. (E) SDS-PAGE (top) and Western
blotting (bottom) of cellular proteins in E. coli XL1
Blue MRF'(pSE380) (lanes 1 and 3), E. coli XL1 Blue
MRF'(pMAT3) (lanes 2 and 4), E. coli IHE
3034-90(pSE380) (lanes 5 and 7), and E. coli IHE
3034-90(pMAT3) (lanes 6 and 8). The bacteria were cultivated at 20°C
(lanes 1, 2, 5, and 6) or at 37°C (lanes 3, 4, 7, and 8). (F) RT-PCR
of RNA from E. coli IHE 3034 (lanes 1 and 2), MG1665
(lanes 3 and 4), and IHE 3034-90 (lanes 5 and 6). The bacteria were
cultivated at 37°C (lanes 1, 3, and 5) or 20°C (lanes 2, 4,and 6).
Amplification was done with a primer pair specific for
matBC.
|
|
Most pathogenic
E. coli strains express more than one
fimbrial type, and recently regulatory cross talk between fimbrial
operons
in
E. coli was reported (
60). We
originally detected Mat fimbriae
in the
fimA sfaA fliC
triple mutant, which raised the question
of whether Mat fimbriae are
expressed in the wild-type IHE 3034
as well. Expression levels of Mat
fimbriae in IHE 3034 mutants
were measured by whole-cell ELISA
technology with anti-Mat fimbria
antisera as primary antibodies. For
screening purposes, the mutations
had been introduced into a
spontaneous streptomycin-resistant
mutant of IHE 3034, IHE
3034-Sm (
45), and it appeared that IHE
3034-Sm
expressed less Mat fimbriae on the cell surface than did
IHE 3034 (Fig.
5A). The mutant strains IHE 3034-2
fimA, IHE 3034-8
sfaA, IHE 3034-59
fimA sfaA, and IHE 3034-79
fimA sfaA matB did
not exhibit expression levels
significantly different from that
shown by IHE 3034-Sm, whereas IHE
3034-90
matB reacted very poorly
with the anti-Mat fimbria
antibodies.
A dramatic difference in Mat fimbria expression was seen between cells
cultivated in Luria broth at 20 and and those cultivated
at 37°C. At
the higher temperature, the bacteria exhibited a very
low level of Mat
fimbria expression, the reactivity with the anti-Mat
antibodies being
closely similar to that seen with the IHE 3034-90
cells (Fig.
5B).
Indirect immunofluorescence staining of IHE 3034
grown at 20°C
indicated that only a fraction of cells, ranging
from 1 to 10% in
different cultures, expressed Mat fimbriae on
their surface (data not
shown). This finding is indicative of
phase variation in the Mat
fimbria expression (
38).
In order to analyze how many genes of the putative
mat gene
cluster are needed for Mat fimbria expression, the
matB::
cat mutation
on the IHE 3034-90
chromosome was complemented in
trans with pSE380
containing
different fragments of the
matB-containing region of
pMAT2
(Fig.
3). The PCR cloning was done on the basis of the MG1655
sequence,
so that in the pSE380 derivative, the
mat genes were
under
the inducible
trc promoter. The expression of the Mat
fimbria
was assessed with bacteria grown at 20°C by agglutination,
whole-cell
ELISA, and IEM with anti-Mat fimbria antibodies.
Complementation
with pMAT11 lacking
matB did not restore Mat
fimbria formation
(Fig.
3), nor did the cells react in whole-cell ELISA
(Fig.
5C)
or in agglutination with the anti-Mat-fimbria antibodies
(data
not shown). Similarly, complementation with
matB alone
in pMAT10
did not restore the surface expression of the Mat fimbriae
(Fig.
3 and
5C). A low level of Mat expression was detected in
E. coli IHE 3034-90(pMAT5) complemented with the
matA-B
DNA, and a higher
expression level was seen in cells complemented with
pMAT9 containing
matBC and with pMAT8 containing
matB-orf1. The expression levels
by the other
complementation derivatives did not differ significantly
from each
other (Fig.
3 and
5C). Expression of the same pMAT plasmids
in
E. coli XL1 Blue MRF' gave essentially similar results (data
not
shown). IEM did not reveal any major differences in the morphology
or
immunological reactivity of the fimbriae of
E. coli
harboring
the pMAT plasmids: examples with pMAT3, pMAT 5, and pMAT9 are
shown in Fig.
1.
A striking feature of the complementation assays detected with
E. coli IHE 3034-90 was that the amount of Mat fimbriae expressed
on
the surface of the complemented strains grown at 37°C was greatly
decreased, as analyzed by whole-cell ELISA (Fig.
5D). We also
analyzed
by Western blotting the amount of MatB in cells of
E. coli
IHE 3034-90(pMAT3) and XL1 Blue MRF'(pMAT3) grown at 37 and
20°C.
MatB was detected in cells grown at 20°C, but only in trace
amounts
or not at all in cells grown at 37°C (Fig.
5E). As a control,
we
expressed under the
trc promoter in pSE380 the
pla gene (pMRK1)
encoding an outer membrane protease.
Analysis of expression of
Pla in IHE 3034-90 by Western blotting
showed expression at similar
amounts at both temperatures (data not
shown).
We used RT-PCR to analyze whether transcription of
matB and
matC is affected by temperature. DNA fragments of the
expected
sizes of
matB (not shown) and
matBC
(Fig.
5F) were amplified from
RNA of IHE 3034 cells grown at 20°C,
and the
matBC signal was
weaker by 70% in cells grown at
37°C. No
matB-C transcripts were
detected in MG1665 or IHE
3034-90 cells at either temperature
(Fig.
5F). A
matA
transcript was detected in all three strains
grown at both
temperatures, whereas PCR amplification with primer
specific for
matAB or
matAC did not produce detectable
amplimers
(data not
shown).
In order to detect other environmental signals besides low temperature
that might influence expression of the Mat fimbria,
we assessed Mat
expression by
E. coli strains IHE 3034, LE392,
and MG1655
grown at 37°C under different conditions. The conditions
included
cultivation in the presence of 5% (vol/vol) CO
2
atmosphere,
0.2% (wt/vol) glucose, 0.2 mM iron chelator 2,2-dipyridyl,
low
(0.1%) or high (2%) concentrations of NaCl, or 10% (vol/vol)
human
blood, as well as anaerobic conditions. None of these conditions
induced detectable Mat fimbria
expression.
Presence of matB and expression of the Mat fimbria
in isolates of E. coli
IHE 3034 belongs to the
serogroup O18acK1H7, which forms the major clonal group of MENEC. These
isolates form a homogenous and distinct group of E.
coli, as analyzed by several phenotypic assays and isoenzyme
polymorphism (30, 31, 51). We analyzed 27 isolates
representing various pathogroups of E. coli (Table 1)
for the presence of matB as well as expression at 20 and
37°C of the Mat fimbria. The analyzed strains belonged to the O18K1H7 MENEC clonal group or to the clonal groups of UPEC (O1K1H7, O4K12H7, O6K2H1, O18K5H7, and O6K13H1), or they represented the diarrhea-causing pathogroups EAEC, EHEC, EPEC, and ETEC. Additionally, K-12 strains and
the widely used UPEC strain 536 were analyzed. PCR and Southern hybridization showed the presence of a matB homolog in
all strains except the two ETEC isolates (Table 1). The apparent size
of the amplified matB fragment in the isolates was
invariant and equalled the one seen in IHE 3034 (data not shown).
However, expression of the Mat fimbria was detected only in the MENEC
isolates grown at 20°C (Table 1).
Hemagglutination by E. coli IHE 3034-79.
Many
fimbrial types of E. coli recognize specific carbohydrate
sequences. In order to test whether this might be the case for the Mat
fimbria as well, we assessed hemagglutination of human erythrocytes by
the strain IHE 3034-79 cultivated at 20°C. No agglutination was
detected; neither did enzymatic treatments known to reveal cryptic
carbohydrates on the erythrocyte surface induce detectable hemagglutination.
 |
DISCUSSION |
Mat fimbria represents a novel type of E. coli
fimbria that is morphologically similar to the type 1 or P fimbriae,
but serologically and in a subunit sequence unrelated to the previously
characterized fimbrial proteins of E. coli or other
bacteria. Although the matB gene encoding the major subunit
was found to be common in E. coli isolates, it was expressed
on the bacterial surface only in the genetically conserved clonal group
of O18acK1H7 MENEC cultivated at low temperature. The matB
gene is the fourth fimbrillin gene detected in laboratory K-12 strains,
which previously have been shown to harbor fim genes
encoding the type 1 fimbria, the csg genes encoding curli,
as well as ppdD encoding the type IV fimbrillin (5,
9,25, 40, 48). Of these, only the type 1 fimbriae are expressed
by E. coli K-12 under routine laboratory conditions at
37°C. Curli expression takes place at low temperature and low osmolarity (40). It was recently found that a fraction of
E. coli isolates from cases of human adult urosepsis also
express curli at 37°C (4). The type IV fimbriae require
an exogeneous secretion apparatus for surface expression in E. coli K-12 (49), but are expressed in EPEC that harbor
the EPEC adherence factor plasmid (35, 36). The
matB fimbrillin gene appears to be common in E. coli and is expressed at low temperature by isolates of a
genetically distinct pathogroup.
matB encodes the major subunit of the Mat fimbria. The
complete nucleotide sequence of matB was determined and the
deduced protein sequence matched the sequence of 57 amino acids
obtained from the Mat fimbria. The knockout
matB::cat mutation abolished Mat
fimbria production, which was complemented in trans by
matB-containing DNA together with at least either
matA or matC. The predicted sequence of MatB was
not related to the fimbrillin sequences deposited in data banks and
lacks the N-terminal motifs of type IV fimbrillins (53)
and CsgA-related fimbrillins (12, 40). MatB also lacks cysteine residues and the C-terminal
-zipper motif of
chaperone-assisted fimbrillins (21). These characteristics
are also lacking in the CooA fimbrillin of the CS1 filaments and in the
other fimbrillins detected on human ETEC strains (46). The
fimbrillins on human ETEC share 40 to 50% sequence identity with each
other, and their plasmid-borne gene clusters are closely related in
gene organization (46). However, we found only 23%
sequence identity between MatB and CooA, and the matA and
matC gene products showed a similar low sequence identity
with the four Coo proteins of the CS1 fimbria (46). The
ELISAs, Western blotting, and IEM with anti-Mat fimbria antibodies
showed that the Mat fimbria was immunologically distinct from the type
1 and S fimbriae expressed by MENEC. We thus conclude that the Mat
fimbria represents a novel fimbrial type of E. coli. We
could not detect any carbohydrate binding by the Mat fimbria and are
currently analyzing the binding of Mat fimbria to epithelial cells and
tissue proteins.
A matB homolog was detected in 25 of the 27 E. coli strains analyzed in this study. The analyzed isolates
represented major pathogroups of E. coli as well as K-12
strains; the two matB-negative strains were ETEC isolates.
The nucleotide sequence of matB of IHE 3034 was 97.8%
identical to the matB from MG1665, and the matB
homologs amplified from the genomic DNA of the E. coli
isolates were of invariable size, also in isolates found not to express MatB. These findings indicate conservation of the matB gene
in E. coli. We detected Mat fimbria expression only in the
O18acK1H7 clonal group of MENEC, and it is noteworthy that the O1K1H7
isolates, which on the basis of isoenzyme polymorphism form a
clonal group of E. coli strains genetically closest to
the O18acK1H7 MENEC group (43, 51), did not express
their matB gene under the conditions we tested.
We subcloned matB from IHE 3034-79 on a 7-kb fragment that
supported Mat fimbria expression when transformed into E. coli K-12. This DNA fragment has a homolog in the MG1665
chromosome at the 6- to 8-min region and contains six putative genes
(5), of which we found matA, matB,
and matC affected Mat fimbria formation. The two chromosomal
regions are highly similar; nucleotide sequencing showed that the
matAB region was 96.6% identical for the sequenced 1,471-bp
fragment, and a high level of identity of the whole 7-kb region was
also evident in the restriction mapping. At present, the number of
genes that are involved in Mat fimbria sythesis and regulation remains
open. We also do not know whether genes located at a distance from the
matB region are involved in fimbria synthesis. The fimbrial
gene clusters of E. coli usually contain four or more genes
needed for the structure, assembly, or regulation of the fimbrial
filament (reviewed in references 20 and 27). Our complementation assays indicated that matB alone is not
sufficient to confer Mat fimbria expression on E. coli XL1
or the strain IHE 3034-90 with the polar
matB::cat mutation. Complementation was
slightly more efficient in the matAB transformant and
further increased in the matBC transformant, but was not
significantly enhanced when fragments encompassing more than the
matBC genes were introduced into IHE 3034 matB::cat or XL1 Blue MRF'. The RT-PCR
analysis indicated that matB and matC are part of
the same transcript, whereas we did not detect a matABC
transcript, which suggests that matA is transcribed
independently from matBC. It is noteworthy that the E. coli strain MG1665 contained a matA transcript, but we
failed to amplify a matBC RNA from this strain. IEM did not
reveal any major structural differences between Mat fimbrial filaments
on E. coli K-12 expressing the pMAT plasmids. Western
blotting of the Mat fimbriae showed the presence of a minor protein
apparently smaller than MatB; its size, however, did not match those of
any of the gene products from the mat region, and it may be
a degradation product from MatB. On the other hand, in trans
expression of mat genes in IHE 3034-90(pMAT3) showed a
minor protein with an apparent size of ca. 20 kDa, which is close to
the calculated size of mature MatC (22.4 kDa). The function of MatC in
fimbria formation remains open. Lack of the chaperone target motif in
the C terminus of MatB suggests that Mat fimbriae are not assembled by
the classical chaperone-usher pathway of the P and the type 1 fimbriae
(20), and the assembly mechanism of the Mat fimbria
remains to be elucidated. The predicted sequence of MatA does not
contain a signal sequence, whereas a putative signal sequence is
present in the matB and matC gene products. The
predicted MatA sequence contained a C-terminal helix-turn-helix DNA-binding motif of the LuxR family of regulatory proteins
(17). This indicates that MatA may be a cytoplasmic
protein functioning in regulation.
We found that transcription of matBC in IHE 3034 cells was
reduced but not abolished at 37°C and that expression of
mat genes from the plasmid pMAT3 with the inducible
trc promoter also was temperature sensitive. These findings
indicate that the temperature regulation of the mat genes
involves transcriptional as well as posttranscriptional events.
Expression of curli in E. coli K-12 is favored at low
temperatures. The transcription of csgA is positively regulated by the RpoS sigma factor and repressed by the histone-like protein H-NS, but the temperature and osmolarity regulation of curli
expression involves other factors (40). The mechanisms of
the temperature regulation of Mat expression remain to be determined. Temperature is known to regulate translation by affecting mRNA conformation (2, 18) or the translational machinery itself (reviewed in reference 22). The matA sequence
contains four copies of putative RNase E target sequences
(37), which might become accessible upon
temperature-induced conformational change. Temperature may also affect
the stability of the MatB protein. The mechanisms behind the repression
of mat expression in most E. coli isolates also
remain open. We found by DNA sequencing and restriction mapping that
the 7-kb mat regions in IHE 3034 and MG1655 are highly
similar, which indicates that the lack of Mat fimbria expression in
E. coli MG1655 does not result from truncation or lack of
genes at this chromosomal region. E. coli IHE 3034 and
another O18acK1H7 MENEC isolate were recently found to be
rpoS mutants (57); whether this holds true for
the entire O18acK1H7 MENEC clone and how RpoS influences mat
expression are to be elucidated. RpoS is a positive regulator of curli
expression, and we indeed have not detected curli expression in IHE
3034 cells cultivated at 20°C (B. Westerlund-Wikström and R. Pouttu, unpublished data). Our ongoing work has shown that silencing of
rpoS does not alone lead to expression of the Mat fimbria.
The regulation of the Mat fimbria expression appears complex and is
particularly interesting because it seems to be a clonal property in
E. coli.
 |
ACKNOWLEDGMENTS |
We thank Kaarina Lähteenmäki for help in initial
electron microscopy and Raili Lameranta, Annu Alho, Lena Blomqvist,
Ulla-Maija Nakari, Riikka Pirilä, and Suvi Simpanen for technical assistance.
This work was supported by the Sigrid Jusélius Foundation, the
Academy of Finland (project no. 42103 and 42107), and the University of Helsinki.
 |
FOOTNOTES |
*
Corresponding author. Mailing address: Division of
General Microbiology, Department of Biosciences, P.O. Box 56 (Viikinkaari 9), FIN-0014 University of Helsinki, Finland. Phone:
358-9-19159260. Fax: 358-9-19159262. E-mail:
timo.korhonen{at}helsinki.fi.
 |
REFERENCES |
| 1.
|
Achtman, M.,
A. Mercer,
B. Kusecek,
A. Pohl,
M. Heuzenroeder,
W. Aaronson,
A. Sutton, and R. P. Silver.
1983.
Six widespread bacterial clones among Escherichia coli K1 isolates.
Infect. Immun.
39:315-335[Abstract/Free Full Text].
|
| 2.
|
Altuvia, S.,
D. Kornitzer,
D. Teff, and A. B. Oppenheim.
1989.
Alternative mRNA structure of the cIII gene of bacteriophage determine the rate of its translation initiation.
J. Mol. Biol.
210:265-280[CrossRef][Medline].
|
| 3.
|
Båga, M.,
S. Normark,
J. Hardy,
P. O'Hanley,
D. Lark,
O. Olsson,
G. Schoolnik, and S. Falkow.
1984.
Nucleotide sequence of the papA gene encoding the Pap pilus subunit of human uropathogenic Escherichia coli.
J. Bacteriol.
157:330-333[Abstract/Free Full Text].
|
| 4.
|
Bian, Z.,
A. Brauner,
Y. Li, and S. Normark.
2000.
Expression of and cytokine activation by Escherichia coli fibers in human sepsis.
J. Infect. Dis.
181:602-612[CrossRef][Medline].
|
| 5.
|
Blattner, F. R.,
G. Plunkett III,
C. A. Bloch,
N. T. Perna,
V. Burland,
M. Riley,
J. Collado-Vides,
J. D. Glasner,
C. K. Rode,
G. F. Mayhew,
J. Gregor,
N. Wayne Davis,
H. A. Kirkpatrick,
M. A. Goeden,
D. J. Rose,
B. Mau, and Y. Shao.
1997.
The complete genome sequence of Escherichia coli K-12.
Science
227:1453-1462.
|
| 6.
|
Bloch, C. A.,
B. A. D. Stocker, and P. E. Orndorf.
1992.
A key role for type 1 pili in enterobacterial communicability.
Mol. Microbiol.
6:697-701[CrossRef][Medline].
|
| 7.
|
Blomfield, I. C.,
M. S. McClain, and B. I. Eisenstein.
1991.
Type 1 fimbriae mutants of Escherichia coli K12: characterization of recognized afimbriate strains and construction of new fim deletion mutants.
Mol. Microbiol.
5:1439-1445[Medline].
|
| 8.
|
Boylan, M.,
D. C. Coleman, and C. J. Smyth.
1987.
Molecular cloning and characterization of the genetic determinant encoding CS3 fimbriae of enterotoxigenic Escherichia coli.
Microb. Pathog.
2:195-209[CrossRef][Medline].
|
| 9.
|
Burland, V.,
G. Plunkett III,
H. J. Sofia,
D. L. Daniels, and F. R. Blattner.
1995.
Analysis of the Escherichia coli genome VI: DNA sequence of the region from 92.8 through 100 minutes.
Nucleic Acids Res.
23:2105-2119[Abstract/Free Full Text].
|
| 10.
|
Caugant, D. A.,
B. R. Levin,
G. Lidin-Janson,
T. S. Whittam,
C. Svanborg-Edén, and R. K. Selander.
1983.
Genetic diversity and relationships among strains of Escherichia coli in the intestine and those causing urinary tract infections.
Prog. Allergy
33:203-227[Medline].
|
| 11.
|
Coligan, J. E.,
A. M. Kruisbeek,
D. H. Margulies,
E. M. Shevach, and W. Strober (ed.).
1994.
Current protocols in immunology.
John Wiley & Sons, New York, N.Y.
|
| 12.
|
Collinson, S. K.,
L. Emödy,
T. J. Trust, and W. W. Kay.
1992.
Thin aggregative fimbriae from diarrheagenic Escherichia coli.
J. Bacteriol.
174:4490-4495[Abstract/Free Full Text].
|
| 13.
|
Frankel, G.,
A. D. Phillips,
I. Rosenshine,
G. Dougan,
J. B. Kaper, and S. Knutton.
1998.
Enteropathogenic and enterohaemorrhagic Escherichia coli: more subversive elements.
Mol. Microbiol.
30:911-921[CrossRef][Medline].
|
| 14.
|
Froehlich, B. J.,
A. Karakashian,
L. R. Melsen,
J. C. Wakefield, and J. R. Scott.
1994.
CooC and CooD are required for assembly of Cs1 pili.
Mol. Microbiol.
12:387-401[CrossRef][Medline].
|
| 15.
|
Hacker, J.,
H. Kestler,
H. Hoschützky,
K. Jann,
F. Lottspeich, and T. K. Korhonen.
1993.
Cloning and characterization of the S fimbrial adhesin II complex of an Escherichia coli O18:K1 meningitis isolate.
Infect. Immun.
61:544-550[Abstract/Free Full Text].
|
| 16.
|
Hacker, J.,
G. Schmidt,
C. Hughes,
S. Knapp,
M. Marget, and W. Goebel.
1985.
Cloning and characterization of genes involved in production of mannose-resistant, neuraminidase-susceptible (X) fimbriae from a uropathogenic O6:K15:H31 Escherichia coli strain.
Infect. Immun.
47:434-440[Abstract/Free Full Text].
|
| 17.
|
Henikoff, S.,
J. C. Wallace, and J. P. Brown.
1990.
Finding protein similarities with nucleotide sequence databases.
Methods Enzymol.
183:111-132[Medline].
|
| 18.
|
Hoe, N. P., and J. D. Goguen.
1993.
Temperature sensing in Yersinia pestis: translation of the LcrF activator protein is thermally regulated.
J. Bacteriol.
175:7901-7909[Abstract/Free Full Text].
|
| 19.
|
Hohn, B., and J. Collins.
1980.
A small cosmid for efficient cloning of large DNA fragments.
Gene
11:291-298[CrossRef][Medline].
|
| 20.
|
Hultgren, S. J.,
C. H. Jones, and S. Normark.
1996.
Bacterial adhesins and their assembly, p. 2730-2756.
In
F. C. Neidhardt, R. Curtiss III, J. L. Ingraham, E. C. C. Lin, K. B. Low, B. Magasanik, W. S. Reznikoff, M. Riley, M. Schaechter, and H. E. Umbarger (ed.), Escherichia coli and Salmonella: cellular and molecular biology, 2nd ed., vol. 2. ASM Press, Washington, D.C.
|
| 21.
|
Hung, D. L.,
S. D. Knight,
R. M. Woods,
J. S. Pinkner, and S. J. Hultgren.
1996.
Molecular basis of two subfamilies of immunoglobulin like chaperones.
EMBO J.
15:3792-3805[Medline].
|
| 22.
|
Hurme, R., and M. Rhen.
1998.
Temperature sensing in bacterial gene regulation what it all boils down to.
Mol. Microbiol.
30:1-6[CrossRef][Medline].
|
| 23.
|
Keskimäki, M.,
M. Saari,
T. Heiskanen, and A. Siitonen.
1998.
Shiga toxin-producing Escherichia coli in Finland from 1990 through 1997: prevalence and characteristics of isolates.
J. Clin. Microbiol.
36:3641-3646[Abstract/Free Full Text].
|
| 24.
|
Keskimäki, M.,
L. Mattila,
H. Peltola, and A. Siitonen.
2000.
Prevalence of diarrheagenic Escherichia coli in Finns with or without diarrhea during a round-the-world trip.
J. Clin. Microbiol.
38:4425-4429[Abstract/Free Full Text].
|
| 25.
|
Klemm, P.
1984.
The fimA gene encoding the type-1 fimbrial subunit of Escherichia coli. Nucleotide sequence and primary structure of the protein.
Eur. J. Biochem.
143:395-399[Medline].
|
| 26.
|
Klemm, P.,
B. J. Jorgensen,
I. van Die,
H. de Ree, and H. Bergmans.
1985.
The fim genes responsible for synthesis of type 1 fimbriae in Escherichia coli, cloning and genetic organization.
Mol. Gen. Genet.
199:410-414[CrossRef][Medline].
|
| 27.
|
Klemm, P., and M. A. Schembri.
2000.
Bacterial adhesins: function and structure.
Int. J. Med. Microbiol.
290:27-35[Medline].
|
| 28.
|
Korhonen, T. K., and J. Finne.
1985.
Agglutination assays for detecting bacterial binding specificities, p. 301-303.
In
T. K. Korhonen, E.A. Dawes, and P. H. Mäkelä (ed.), Enterobacterial surface antigens: methods for molecular characterization. Elsevier Science Publishers, Amsterdam, The Netherlands.
|
| 29.
|
Korhonen, T. K.,
E. L. Nurmiaho,
H. Ranta, and C. Svanborg-Edén.
1980.
New method for isolation of immunologically pure pili from Escherichia coli.
Infect. Immun.
27:569-575[Abstract/Free Full Text].
|
| 30.
|
Korhonen, T. K.,
V. Väisänen-Rhen,
M. Rhen,
A. Pere,
J. Parkkinen, and J. Finne.
1984.
Escherichia coli fimbriae recognizing sialyl galactosides.
J. Bacteriol.
159:762-766[Abstract/Free Full Text].
|
| 31.
|
Korhonen, T. K.,
M. V. Valtonen,
J. Parkkinen,
V. Väisänen-Rhen,
J. Finne,
F. Ørskov,
I. Ørskov,
S. B. Svenson, and P. H. Mäkelä.
1985.
Serotypes, hemolysin production and receptor recognition of Escherichia coli strains associated with neonatal sepsis and meningitis.
Infect. Immun.
48:486-491[Abstract/Free Full Text].
|
| 32.
|
Lintermans, P.,
P. Pohl,
F. Deboeck,
A. Bertels,
C. Schlicker,
J. Vandekerckhove,
J. Van Damme,
M. Van Montagu, and H. De Greve.
1998.
Isolation and nucleotide sequence of the F17-A gene encoding the structural protein of the F17 fimbriae in bovine enterotoxigenic Escherichia coli.
Infect. Immun.
56:1475-1484.
|
| 33.
|
McMichael, J. C., and J. T. Ou.
1979.
Structure of common pili from Escherichia coli.
J. Bacteriol.
138:969-975[Abstract/Free Full Text].
|
| 34.
|
Miller, V. L., and J. J. Mekalanos.
1988.
A novel suicide vector and its use in construction of insertion mutations: osmoregulation of outer membrane proteins and virulence determinants in Vibrio cholerae requires toxR.
J. Bacteriol.
170:2575-2583[Abstract/Free Full Text].
|
| 35.
|
Nataro, J. P., and J. B. Kaper.
1998.
Diarrheagenic Escherichia coli.
Clin. Microbiol. Rev.
11:142-201[Abstract/Free Full Text].
|
| 36.
|
Nataro, J. P.,
L. C. A. Scaletsky,
J. B. Kaper,
M. M. Levine, and L. R. Trabulsi.
1985.
Plasmid-mediated factors conferring diffuse and localized adherence of enteropathogenic Escherichia coli.
Infect. Immun.
48:378-383[Abstract/Free Full Text].
|
| 37.
|
Nilsson, P., and B. E. Uhlin.
1991.
Differential decay of a polycistronic Escherichia coli is initiated by RNaseE-dependent endonucleolytic processing.
Mol. Microbiol.
5:1791-1799[Medline].
|
| 38.
|
Nowicki, B.,
M. Rhen,
V. Väisänen-Rhen,
A. Pere, and T. K. Korhonen.
1984.
Immunofluorescence study of fimbrial phase variation in Escherichia coli KS71.
J. Bacteriol.
160:691-695[Abstract/Free Full Text].
|
| 39.
|
Olsén, A.,
A. Jonsson, and S. Normark.
1989.
Fibronectin binding mediated by a novel class of surface organelles on Escherichia coli.
Nature
338:652-655[CrossRef][Medline].
|
| 40.
|
Olsén, A.,
A. Arnqvist,
M. Hammar,
S. Sukupolvi, and S. Normark.
1993.
The RpoS sigma factor relieves H-NS-mediated transcriptional repression of csgA, the subunit gene of fibronectin-binding curli in Escherichia coli.
Mol. Microbiol.
7:523-536[CrossRef][Medline].
|
| 41.
|
Paunio, M.,
R. Peabody,
M. Keskimäki,
M. Kokki,
P. Ruutu,
S. Oinonen,
V. Vuotari,
A. Siitonen,
E. Tast, and P. Leinikki.
1999.
Swimming associated outbreak of enterohemorrhagic Escherichia coli (EHEC) O157:H7.
Epidemiol. Infect.
122:1-5[CrossRef][Medline].
|
| 42.
|
Pere, A.,
B. Nowicki,
H. Saxén,
A. Siitonen, and T. K. Korhonen.
1987.
Expression of P, type-1, and type-1C fimbriae of Escherichia coli in the urine of patients with acute urinary tract infection.
J. Infect. Dis.
156:567-574[Medline].
|
| 43.
|
Pere, A.,
R. K. Selander, and T. K. Korhonen.
1988.
Characterization of P fimbriae on O1, O7, O75, rough, and nontypable strains of Escherichia coli.
Infect. Immun.
56:1288-1294[Abstract/Free Full Text].
|
| 44.
|
Perez-Casal, J.,
J. S. Swartley, and J. R. Scott.
1990.
Gene encoding the major subunit of CS1 pili of human enterotoxigenic Escherichia coli.
Infect. Immun.
58:3594-3600[Abstract/Free Full Text].
|
| 45.
|
Pouttu, R.,
T. Puustinen,
R. Virkola,
J. Hacker,
P. Klemm, and T. K. Korhonen.
1999.
Amino-acid residue Ala-62 in the FimH fimbrial adhesin is critical for the adhesiveness of meningitis-associated Escherichia coli to collagens.
Mol. Microbiol.
31:1747-1757[CrossRef][Medline].
|
| 46.
|
Sakellaris, H., and J. R. Scott.
1998.
New tools in an old trade: CS1 pilus morphogenesis.
Mol. Microbiol.
30:681-687[CrossRef][Medline].
|
| 47.
|
Sambrook, J.,
E. F. Fritsch, and T. Maniatis.
1989.
Molecular cloning: a laboratory manual, 2nd ed.
Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.
|
| 48.
|
Sauvonnet, N.,
P. Gounon, and A. P. Pugsley.
2000.
PpdD type IV pilin of Escherichia coli K-12 can be assembled into pili in Pseudomonas aeruginosa.
J. Bacteriol.
182:848-854[Abstract/Free Full Text].
|
| 49.
|
Sauvonnet, N.,
G. Vignon,
A. P. Pugsley, and P. Gounon.
2000.
Pilus formation and protein secretion by the same machinery in Escherichia coli.
EMBO J.
19:2221-2228[CrossRef][Medline].
|
| 50.
|
Selander, R. K., and B. R. Lewin.
1980.
Genetic diversity and structure in Escherichia coli populations.
Science
210:545-547[Abstract/Free Full Text].
|
| 51.
|
Selander, R. K.,
T. K. Korhonen,
V. Väisänen-Rhen,
P. H. Williams,
P. E. Pattison, and D. A. Caugant.
1986.
Genetic relationships and clonal structure of strains of Escherichia coli causing neonatal septicemia and meningitis.
Infect. Immun.
52:213-222[Abstract/Free Full Text].
|
| 52.
|
Sokurenko, E. V.,
V. Chesnokova,
D. E. Dykhuizen,
I. Ofek,
X.-R. Wu,
K. A. Krogfelt,
C. Struve,
M. A. Schembri, and D. L. Hasty.
1998.
Pathogenic adaptation of Escherichia coli by natural variation of the FimH adhesin.
Proc. Natl. Acad. Sci. USA
95:8922-8926[Abstract/Free Full Text].
|
| 53.
|
Strom, M. S., and S. Lory.
1993.
Structure function and biogenesis of the type IV pili.
Annu. Rev. Microbiol.
47:565-596[CrossRef][Medline].
|
| 54.
|
Tietze, E.,
J. Brevet,
H. Tschäpe, and W. Voigt.
1988.
Cloning and preliminary characterization of the streptothricin resistance determinants of the transposons Tn 1825 and Tn 1826.
J. Basic Microbiol.
28:129-136[Medline].
|
| 55.
|
Väisänen-Rhen, V.,
J. Elo,
E. Väisänen,
A. Siitonen,
I. Ørskov,
F. Ørskov,
S. B. Svenson,
P. H. Mäkelä, and T. K. Korhonen.
1984.
P-fimbriated clones among uropathogenic Escherichia coli strains.
Infect. Immun.
43:149-155[Abstract/Free Full Text].
|
| 56.
|
Virkola, R.,
J. Parkkinen,
J. Hacker, and T. K. Korhonen.
1993.
Sialyloligosaccharide chains of laminin as an extracellular matrix target for S fimbriae of Escherichia coli.
Infect. Immun.
61:4480-4484[Abstract/Free Full Text].
|
| 57.
|
Wang, Y., and K. S. Kim.
2000.
Effect of rpoS mutations on stress-resistance and invasion of brain microvascular endothelial cells in Escherichia coli K1.
FEMS Lett.
182:241-247.
|
| 58.
|
Westerlund-Wikström, B.,
J. Tanskanen,
R. Virkola,
J. Hacker,
M. Lindberg,
M. Skurnik, and T. K. Korhonen.
1997.
Functional expression of adhesive peptides as fusions to Escherichia coli flagellin.
Prot. Eng.
10:1319-1326[Abstract/Free Full Text].
|
| 59.
|
Whittam, T. S.
1996.
Genetic variation and evolutionary processes in natural populations of Escherichia coli, p. 2708-2720.
In
F. C. Neidhardt, R. Curtiss III, J. L. Ingraham, E. C. C. Lin, K. B. Low, B. Magasanik, W. S. Reznikoff, M. Riley, M. Schaechter, and H. E. Umbarger (ed.), Escherichia coli and Salmonella: cellular and molecular biology, 2nd ed., vol. 2. ASM Press, Washington D.C.
|
| 60.
|
Xia, Y.,
D. Gally,
K. Forsman-Semb, and B. E. Uhlin.
2000.
Regulatory cross-talk between adhesin operons in Escherichia coli: inhibition of type 1 fimbriae expression by the PapB-protein.
EMBO J.
19:1450-1457[CrossRef][Medline].
|
| 61.
|
Ylönen, A.,
A. Rinne,
J. Herttuainen,
J. Bögwald,
M. Järvinen, and N. Kalkkinen.
1999.
Atlantic salmon (Salmo salar L.) skin contains a novel kininogen and another cysteine proteinase inhibitor.
Eur. J. Biochem.
266:1-8[Medline].
|
Journal of Bacteriology, August 2001, p. 4727-4736, Vol. 183, No. 16
0021-9193/01/$04.00+0 DOI: 10.1128/JB.183.16.4727-4736.2001
Copyright © 2001, American Society for Microbiology. All rights reserved.
This article has been cited by other articles:
-
Blackburn, D., Husband, A., Saldana, Z., Nada, R. A., Klena, J., Qadri, F., Giron, J. A.
(2009). Distribution of the Escherichia coli Common Pilus among Diverse Strains of Human Enterotoxigenic E. coli. J. Clin. Microbiol.
47: 1781-1784
[Abstract]
[Full Text]
-
Saldana, Z., Erdem, A. L., Schuller, S., Okeke, I. N., Lucas, M., Sivananthan, A., Phillips, A. D., Kaper, J. B., Puente, J. L., Giron, J. A.
(2009). The Escherichia coli Common Pilus and the Bundle-Forming Pilus Act in Concert during the Formation of Localized Adherence by Enteropathogenic E. coli. J. Bacteriol.
191: 3451-3461
[Abstract]
[Full Text]
-
Xicohtencatl-Cortes, J., Monteiro-Neto, V., Saldana, Z., Ledesma, M. A., Puente, J. L., Giron, J. A.
(2009). The Type 4 Pili of Enterohemorrhagic Escherichia coli O157:H7 Are Multipurpose Structures with Pathogenic Attributes. J. Bacteriol.
191: 411-421
[Abstract]
[Full Text]
-
Nuccio, S.-P., Baumler, A. J.
(2007). Evolution of the Chaperone/Usher Assembly Pathway: Fimbrial Classification Goes Greek. Microbiol. Mol. Biol. Rev.
71: 551-575
[Abstract]
[Full Text]
-
Rendon, M. A., Saldana, Z., Erdem, A. L., Monteiro-Neto, V., Vazquez, A., Kaper, J. B., Puente, J. L., Giron, J. A.
(2007). Commensal and pathogenic Escherichia coli use a common pilus adherence factor for epithelial cell colonization. Proc. Natl. Acad. Sci. USA
104: 10637-10642
[Abstract]
[Full Text]
-
Antikainen, J., Kupannen, V., Lahteenmaki, K., Korhonen, T. K.
(2007). pH-Dependent Association of Enolase and Glyceraldehyde-3-Phosphate Dehydrogenase of Lactobacillus crispatus with the Cell Wall and Lipoteichoic Acids. J. Bacteriol.
189: 4539-4543
[Abstract]
[Full Text]
-
Seshadri, R., Joseph, S. W., Chopra, A. K., Sha, J., Shaw, J., Graf, J., Haft, D., Wu, M., Ren, Q., Rosovitz, M. J., Madupu, R., Tallon, L., Kim, M., Jin, S., Vuong, H., Stine, O. C., Ali, A., Horneman, A. J., Heidelberg, J. F.
(2006). Genome Sequence of Aeromonas hydrophila ATCC 7966T: Jack of All Trades. J. Bacteriol.
188: 8272-8282
[Abstract]
[Full Text]
-
Holden, N. J., Totsika, M., Mahler, E., Roe, A. J., Catherwood, K., Lindner, K., Dobrindt, U., Gally, D. L.
(2006). Demonstration of regulatory cross-talk between P fimbriae and type 1 fimbriae in uropathogenic Escherichia coli.. Microbiology
152: 1143-1153
[Abstract]
[Full Text]
-
Mann, B., Orihuela, C., Antikainen, J., Gao, G., Sublett, J., Korhonen, T. K., Tuomanen, E.
(2006). Multifunctional Role of Choline Binding Protein G in Pneumococcal Pathogenesis. Infect. Immun.
74: 821-829
[Abstract]
[Full Text]
-
Harakava, R., Gabriel, D. W.
(2003). Genetic Differences between Two Strains of Xylella fastidiosa Revealed by Suppression Subtractive Hybridization. Appl. Environ. Microbiol.
69: 1315-1319
[Abstract]
[Full Text]