Previous Article | Next Article ![]()
Journal of Bacteriology, May 2001, p. 2765-2773, Vol. 183, No. 9
Institute for Virus Research, Kyoto
University, Kyoto 606-8507,1 Department of
Biophysics2 and Department of
Physics,4 Faculty of Science, Kyoto University,
Kyoto 606-8502, Yakult Central Institute for Microbiological
Research, Kunitachi, Tokyo 186-0011,3 and
Biomedical Group, Takara Shuzo Co. Ltd., Seta, 3-4-1, Otsu,
Shiga 520-2193,5 Japan
Received 9 November 2000/Accepted 6 February 2001
Protein D has previously been demonstrated to be associated with
Escherichia coli ribosomes by the radical-free and highly reducing method of two-dimensional polyacrylamide gel electrophoresis. In this study, we show that protein D is exclusively present in the 30S
ribosomal subunit and that its gene is located at 33.6 min on the
E. coli genetic map, between ompC and
sfcA. The gene consists of 45 codons, coding for a protein
of 5,096 Da. The copy number of protein D per ribosomal particle varied
during growth and increased from 0.1 in the exponential phase to 0.4 in
the stationary phase. For these reasons, protein D was named SRA
(stationary-phase-induced ribosome-associated) protein and its gene was
named sra. The amount of SRA protein within the cell was
found to be controlled mainly at the transcriptional level: its
transcription increased rapidly upon entry into the stationary phase
and was partly dependent on an alternative sigma factor (sigma S). In
addition, global regulators, such as factor inversion stimulation
(FIS), integration host factor (IHF), cyclic AMP, and ppGpp, were found
to play a role either directly or indirectly in the transcription of
sra in the stationary phase.
The ribosomal proteins of
Escherichia coli were systematically characterized in the
beginning of the 1970s, and a unified nomenclature, S1 through S21 for
the 30S subunit and L1 through L34 for the 50S subunit, was proposed on
the basis of their behavior in two-dimensional gel electrophoresis
(17, 44, 45, 46). Using a modified and improved method,
termed radical-free and highly reducing method of two-dimensional
polyacrylamide gel electrophoresis (RFHR 2-D PAGE), we discovered four
additional proteins, proteins A, B, C, and D, that were associated with
E. coli ribosomes (38, 39, 40).
The gene for protein A (40) was located between
infC (initiation factor 3) and rplT (ribosomal
protein L20) (26, 27, 31) at 38 min, suggesting that the
three constitute a new ribosomal protein operon in E. coli.
The gene for protein B (40) was found to be identical to
the protein X gene of the spc operon (8). Proteins A and B were consequently named L35 and L36 and their genes
were named rpmI and rpmJ, respectively, in
accordance with the standard nomenclature for E. coli
ribosomal proteins and their genes. Protein C (41) is
likely to be the full-length product of the rpmE gene,
coding for L31, because the N-terminal amino acid sequence completely
matches that of L31 and the molecular mass of protein C is larger than
that of L31 by about 1,000 Da. More recently, L31 was proved to arise
through cleavage of protein C by protease VII, an outer membrane enzyme
(A. Wada, unpublished data).
Protein D is a small basic protein that can be isolated from the 30S
subunit after dissociation of the 70S ribosome. It migrates much faster
than S21 and to a point below the L32 spot upon RFHR 2-D PAGE of
purified 70S ribosomal proteins. Thus, it is the smallest protein
component of the 30S subunit of E. coli. When the 70S ribosome was dissociated into the core particle and split proteins by
CsCl density gradient centrifugation (34), protein D was found in the soluble split-protein fraction (39).
Furthermore, in simultaneous reconstitution experiments with 50S and
30S subunits, protein D was exclusively associated with the 30S subunit
(39).
In this study, we have identified the gene encoding protein D by
determining its N-terminal amino acid sequence and have analyzed the
mechanism of control of its expression in terms of growth phase and the
transcriptional factors involved. Protein D was named SRA
(stationary-phase-induced ribosome-associated) protein.
Bacterial strains, plasmids, phage, and culture conditions.
E. coli K-12 strains, plasmids, and phage (Table
1) were grown in medium E
(37) containing 2% Polypeptone and supplemented with
0.5% glucose (EP medium) at 37°C with shaking at 100 cycles/min. Cells were harvested in the middle exponential and/or stationary phase
of cell growth and stored at
0021-9193/01/$04.00+0 DOI: 10.1128/JB.183.9.2765-2773.2001
Copyright © 2001, American Society for Microbiology. All rights reserved.
Escherichia coli Ribosome-Associated
Protein SRA, Whose Copy Number Increases during Stationary
Phase


![]()
ABSTRACT
Top
Abstract
Introduction
Materials and Methods
Results
Discussion
References
![]()
INTRODUCTION
Top
Abstract
Introduction
Materials and Methods
Results
Discussion
References
![]()
MATERIALS AND METHODS
Top
Abstract
Introduction
Materials and Methods
Results
Discussion
References
80°C until use.
TABLE 1.
Bacterial strains, phage, and plasmids
Preparation of ribosomes, ribosomal subunits, and ribosomal
proteins.
Crude and high-salt-washed ribosomes were prepared
according to the methods of Noll et al. (29) and Horie et
al. (16). Subunits were isolated from the high-salt-washed
ribosome preparation by sucrose density gradient centrifugation as
described previously (38). Proteins were prepared by the
acetic acid method of Hardy et al. (13), dialyzed against
2% acetic acid, lyophilized, and stored at
80°C until use.
RFHR 2-D PAGE and determination of copy number of SRA (protein D). Lyophilized ribosomal proteins (approximately 0.3 mg/gel) were analyzed by RFHR 2-D PAGE as described previously (38) with the following modifications: the volume of glacial acetic acid used in the sample charging buffer (50×) was 7.4 ml, and the gel thickness used was 2 mm. After the gels were stained with amido black 10B in 1% acetic acid and destained with 1% acetic acid, the protein spots on the gels were scanned with a PD 110 personal densitometer (Molecular Dynamics Co.). The copy number of SRA (protein D) was determined by calculating the optical density values obtained per unit of molecular weight and normalizing them with the average values for S18, S19, L32, and L33, each of which has one copy per ribosome (38). The standard deviations for these calculations were approximately 25%.
Amino acid sequence analysis of SRA. After electrophoresis, the SRA protein was blotted from the gel to a polyvinylidene difluoride membrane. Sequence analysis was performed using a model 477A protein sequencer (Perkin-Elmer Applied Biosystems) as described previously (42).
Gene locus and nucleotide sequencing.
The amino acid
sequence data obtained were used to design a degenerate probe:
AAT/CCGT/CCAA/GGCT/C/ G/ACGT/CCAT/CATT/CCTGGG. The probe was used to screen Kohara
clone library clones
(19). Positive clones obtained were 1G9
(277), 9B8 (278), and 10C7
(279), which are located at 33 min. A chromosomal insert
in clone 277 was subcloned into either pUC118 or pUC119, and the
fragment containing the sra gene was sequenced by the
dideoxy method (24).
Construction of
pF13(Psra-lacZ).
Five regions
upstream of the ATG initiation codon of the sra gene as well
as 39 bp downstream of it were amplified by PCR. The primers used
contained a KpnI site to facilitate cloning into the pMS4342
plasmid vector for operon fusion. The inserts thus cloned were
recombined in vivo into phage vector
pF13 (15, 50), and
the resulting phage,
pF13(Psra-lacZ), was lysogenized into strain KY1461. The forward primers used and the distances (base
pairs) from the ATG initiation codon (in parentheses) are as follows:
5'-CGGGTACCGGATATTCCGAATAAAATCCGG-3' (595),
5'-GCGGTACCTCATGGTGTTAAAATATAAA-3' (455),
5'-GCGGTACCGAATCACTAGTTTACTTAT-3' (325),
5'-GCGGTACCCTGACCAAATGGGTTGAAGC-3' (200), and
5'-GCGGTACCCACGTGTTTCTTCGCTACGG-3' (62). The reverse primer,
5'-CGGTCGACCAGTCCAAGAATATGACGTGCC-3', contained a
SalI site. The DNA of plasmid pKV7350 was used as a template
in all PCRs. The correctness of the sequences of the PCR products was confirmed by nucleotide sequencing. Unless otherwise stated,
pF13(Psra-lacZ) with the region 595 bp upstream of the
ATG of sra was used throughout this work.
Measurement of the level of transcription of the sra
gene.
The level of transcription was estimated by measuring the
-galactosidase activity of the lacZ reporter in each
lysogen constructed as described above. For the integration host factor
(IHF)- or cyclic AMP (cAMP)-defective mutant into which
pF13(Psra-lacZ) could not be lysogenized, plasmid
pFF6(Psra-lacZ) (18), a mini-F plasmid
derivative carrying an ara-trp-lac fusion identical to that
carried by
pF13, was used instead.
Determination of
-galactosidase activity.
Aliquots (0.1, 0.2, or 0.5 ml) of a culture were mixed with Z buffer (0.9, 0.8, or 0.5 ml, respectively) in an ice bath. Cells were disrupted by the addition
of chroroform and sodium dodecyl sulfate and were assayed for
-galactosidase activity essentially as described by Miller
(28). The average of four to eight assays is reported.
Construction of deletions of the sra gene.
The
regions flanking the sra gene were amplified by PCR using
pKV7350 (pUC119-277L) as the template and
5'-TTTAACTCCTCAATCCTGTAGCTAG-3' and
5'-TTCATAACCATCAGTCCTCAATGAC-3' as the primers. The
resultant PCR product was restricted with HincII and ligated
into a kanamycin-resistant cassette with HincII sites at
both ends (derived from plasmid pUC-4K). Whether plasmid pKV7351
(pUC119-277L-sra::kan) was correctly constructed or not was examined by nucleotide sequencing. The plasmid
was then linearized with SphI and EcoRI and
transformed into MG1655 cells carrying plasmid pBAD-

, which
increases recombination frequency (51).
Kanamycin-resistant transformants were selected, and deletion of the
sra gene in them was confirmed by PCR. Subsequently, P1
phage prepared on one of the transformants was used to transduce MG1655
cells, and kanamycin-resistant transductants were selected. The
sra gene deletion was similarly confirmed by PCR, and
the strain was designated
MG1655
sra::kan.
Primer extension.
MG1655,
MG1655
sra::kan, and MG1655 carrying
pKY7350 (pUC119-277L) were grown at 37°C in 10 ml of
Luria-Bertani medium to the stationary phase of growth (2 h after
cessation of the turbidity increase). Cells in 1 ml of culture were
harvested by centrifugation at 5,000 × g for 15 min,
and RNA was extracted using an RNA-DNA extraction kit (Qiagen Inc.).
All solutions were treated with diethylpyrocarbonate (Sigma) prior to
use. The concentration of RNA was estimated from the absorbance at 260 nm, and the quality and degree of degradation of RNA were assessed by
electrophoresis on a 1.5% agarose gel containing 1.8% formaldehyde.
The primer used for extension was complementary to the coding region of
sra and was
5'-TTATGGTCCAGTCCAAGAATATGACGTGCCTGACGGTTCG-3'. For the primer extension assays, 10 pmol of a 32P-end-labeled
oligonucleotide primer and 40 µg of RNA template were mixed, heated
at 65°C for 90 min, and annealed by allowing the mixture to cool
slowly to room temperature. The extension reaction was performed
according to the method described by Triezenberg (35). The
reaction mixtures were boiled for 2 min and loaded onto a 5%
denaturing polyacrylamide sequencing gel. The sequencing reaction was
performed using a BcaBEST dideoxy sequencing kit (Takara)
and 3.2 pmol of the same primer as that used for the primer extension reaction.
| |
RESULTS |
|---|
|
|
|---|
SRA is present exclusively in ribosomal particles.
Strain
W3110 was cultured and harvested at the stationary phase (after 24 h of growth), and cell extracts, crude ribosomes, high-salt-washed
ribosomes, and the dissociated 30S subunit were prepared and analyzed
by RFHR 2-D PAGE (Fig. 1). Subsequently, the quantity of SRA protein on each electropherogram was
densitometrically determined as described in Materials and Methods. The
copy number of the SRA protein was about 0.4 per ribosome in the cell
extracts, and the level was maintained in the subsequent processes of
ribosome preparation, including dissociation into subunits. These
results indicate that SRA is strongly associated with 30S subunit
particles not only in the exponential phase, as described previously
(38), but also in the stationary phase. Free SRA protein
was not detected in the soluble fraction after sedimentation of crude
ribosomes by centrifugation at 165,000 × g for 90 min
(data not shown). Therefore, we believe that SRA is an integral part of
the ribosome, especially of the 30S subunit.
|
The copy number of SRA is dependent upon the cellular growth
phase.
Cells of strain W3110 were harvested in the middle
exponential to late stationary phase of growth, and the proteins
prepared from crude ribosomes were analyzed by RFHR 2-D PAGE. The
results shown in Fig. 2 demonstrate that
the copy number of SRA increased from 0.1 in the middle exponential
phase to 0.4 in the stationary phase. Cell viability remained constant
at 70% or more during the 4 days of culturing (Fig. 2).
|
Amino acid sequence analysis of SRA. An RFHR 2-D PAGE gel of 70S ribosomal proteins was blotted onto a polyvinylidene difluoride membrane, and the SRA spot was subjected to protein sequence analysis. The sequence of the first 37 amino acid residues from the N terminus was MKSNRQARHILGLDHKISNQRKIVTEGDKSSVVNNPT. A protein with this sequence has not yet been identified among the ribosomal proteins or ribosome-associated proteins from E. coli or any other organism. We identified this protein in 1992 (unpublished data) when E. coli genome sequencing had not yet been completed.
Gene locus and DNA sequence of the sra gene. A mixed DNA probe (26-mer) (described in Materials and Methods) was synthesized based on the amino acid sequence of the SRA protein from the fourth asparagine so as to perform screening of Kohara clones (19). Clones 1G9 (#277), 9B8 (#278), and 10C7 (#279) were found to hybridize with the probe. They are all located at 33.6 min on the E. coli genetic map. A total of 2,257 bp containing the gene (138 bp) for SRA (i.e., sra) was sequenced using the dideoxy method (reference 24 and data not shown).
The sra gene has 45 codons and is terminated with TAA. The nucleotide sequence was in complete agreement with the amino acid sequence of SRA described above. The molecular mass of the SRA protein was calculated to be 5,096 Da, a value distinctly smaller than the value of 5,900 Da estimated from its migration in RFHR 2-D PAGE (39). The pl was calculated to be 11.6. The absence of cysteine residues is consistent with results obtained by the iodoacetic acid method (39). The gene has a typical Shine-Dalgarno sequence and a rho-independent terminator forming a distinct hairpin loop. However, there is no clear consensus sequence for the
10 and
35 promoter regions (described in more detail below). A DNA fragment containing the gene was previously sequenced by Mahajan et al.
(23) as part of the region upstream of the gene for a translational fusion protein (sfcA-recE). Both sequences
were identical across the coding region boundary. The sequence was also
consistent with the genomic sequencing data reported by both a Japanese
group (http://ecoli.aist-nara.ac.jp/) and a Wisconsin group
(6).
The nucleotide sequence data were registered at DDBJ/EMBL/GenBank in
1992 under accession number D13179. At that time, we assigned protein D
and its gene as ribosome protein S22 and gene rpsV,
respectively. However, as described above, we have changed the name of
the protein to SRA and the name of its gene to sra, mainly
because of the very low copy number of the protein in the 30S ribosomal
subunit, especially in exponentially growing cells.
Construction and characterization of an sra deletion
mutant.
An sra disruptant
(MG1655
sra::kan) was constructed as
described in Materials and Methods, and its disruption was confirmed by
PCR and Northern and Western blot analyses (data not shown) (see below
for Northern analysis). To analyze the phenotype of the mutant, it was
grown at 37°C for 6 to 7 days in either Luria broth or EP medium
along with the parental wild-type strain (MG1655). Samples of each
culture were withdrawn at various times from the exponential phase
through the stationary phase of growth, and colony-forming ability was
tested. Very few differences were observed between the strains (data
not shown).
The level of transcription of the sra gene is increased
in the stationary growth phase.
As described above, the copy
number of the SRA protein per ribosome increased during the stationary
phase. To elucidate the control mechanism for sra gene
expression, we analyzed the level of expression of sra
during the transition from the exponential phase to the stationary
phase of growth by measuring
-galactosidase activity with
lacZ reporters.
pF13(Psra-lacZ) (Fig.
3A) lysogen of strain MG1655 was grown in
EP medium, and its
-galactosidase activity was monitored at
different times during growth. The activity was low during the
exponential phase but increased substantially when cells entered the
stationary phase (Fig. 3B). The same results were obtained with
the
pF13(Psra-lacZ) lysogen of strain KY1461. These results suggest that the increase in the amount of SRA resulted from an increased level of trancription of the sra gene.
|
Effects of sigma S and global regulators on the transcription of
sra.
It is known that RNA polymerase with sigma S
transcribes a large number of genes in the stationary phase. We
examined whether the expression of the sra gene is dependent
on sigma S. An rpoS mutant strain, KY1461
katF::tet (KY1471), as well as
parental wild-type strain KY1461, carrying one copy of
pF13(Psra-lacZ), was grown at 37°C in EP medium. The
level of expression of sra in both exponential- and
stationary-phase cultures was estimated by measuring
-galactosidase
activity. The level of expression of sra in the exponential
phase was low in both the rpoS mutant strain and the
wild-type strain. In contrast, when cultures entered the stationary
phase, sra expression increased in the wild-type strain but
not in the rpoS mutant strain, which showed only about 30%
the sra expression of the wild-type strain (Fig.
4).
|
-galactosidase activities of a PbolA-lacZ operon fusion
in the presence and absence of active sigma S. The
-galactosidase
activity in the stationary phase of a
pF13(Psra-lacZ)
lysogen of KY1461 was twice that of a
pF13(PbolA-lacZ) lysogen carrying an rpoS mutation (data not shown). As a
further control, we assayed the level of expression of the
rmf gene (49), which is sigma S independent. As
anticipated, the
-galactosidase activities of a
pF13(Prmf-lacZ) lysogen were the same in the stationary
phase regardless of the rpoS mutation (unpublished data). We
interpret these results to indicate that the transcription of
sra in the stationary phase is partly dependent on sigma S.
Many E. coli genes whose expression is enhanced in the
stationary phase, regardless of whether the expression is dependent on
rpoS, are also regulated either positively or negatively by other global regulators (for example, see reference 14).
We examined the effects of some global regulators (factor inversion stimulation [FIS], H-NS, OmpR, cAMP, ppGpp, and IHF) on the
expression of sra by using global regulator-defective
mutants lysogenized with
pF13(Psra-lacZ) or carrying
pFF6(Psra-lacZ) and by measuring
-galactosidase activity.
In the exponential phase, only a few differences were observed between
the wild-type strains and the mutants defective in FIS, H-NS, IHF,
OmpR, cAMP, and ppGpp. However, the expression of sra during
the stationary phase in the mutants defective in FIS, IHF, cAMP, and
ppGpp was significantly lower than that in the corresponding wild-type
strains, as shown in Fig. 4. The only exception was an
ompR-defective mutant in which sra expression was
slightly higher (Fig. 4). These results suggest that FIS, IHF, cAMP,
and ppGpp are involved in the positive regulation of sra
expression during the stationary growth phase.
Determination of the transcriptional start site of sra
by primer extension.
Based on the DNA sequence data alone, it was
difficult to predict the promoter sequence of the sra gene.
Therefore, its transcriptional start site was experimentally determined
by primer extension using mRNA prepared from stationary-phase cells.
The start site of the major transcript of sra was determined
to be located at the 83rd C counted from the translational initiation
codon (ATG) of sra (Fig. 5).
The sra transcript was not observed in the stationary-phase culture of the sra deletion mutant strain. The
10 region
for the sra promoter is likely to be 5'-TATGCT-3',
and the
35 region is likely to be 5'-AGCACC-3'.
Since no other transcripts were observed for the region about 600 bp upstream of the translational initiation codon, the promoter
identified here is the major one for the sra gene. By
Northern analysis, only one sra transcript was detected in
the stationary-phase culture, but no transcript was observed in the
exponential-phase culture. These results are consistent with the
-galactosidase reporter assay results described above.
|
55, although these transcripts were not analyzed further.
Effects of upstream cis elements on sra
transcription.
Experimental determination of the transcriptional
start site of the sra gene led to the prediction of the
10
and
35 regions of the sra promoter. Based on these data,
we searched in the region upstream of the sra promoter
elements for likely cis elements that might be recognized by
global regulators of transcription. sra-lacZ fusion
constructs containing regions 595, 455, 325, 200, or 62 bp upstream of
the initiation (ATG) codon of sra (see Materials and
Methods) were used for this purpose, and the
-galactosidase activity
of cell samples taken at various times was assayed (Fig. 6). The sra
62 construct
showed very low activity, most likely because it lacked some of the
promoter elements. The sra
200 and sra
325
constructs, which contained the sra promoter, were both
active, but the sra
455 construct showed about 75% higher
-galactosidase activity. These results suggested that the region from
455 to
325 bp might contain a cis element(s) that
can be recognized by one or more of the global regulators that were
shown to positively affect sra expression in the stationary
phase (Fig. 4).
|
Homologous genes in other bacteria.
To determine to what
extent the sra gene is phylogenetically conserved in other
organisms, nucleotide and protein databases were searched by BLAST.
Homologous genes were identified in Salmonella enterica
serovars Typhimurium, Typhi, and Paratyphi and Klebsiella pneumoniae (Fig. 7A). The genes in
these bacteria code for proteins of 47, 47, 41, and 46 amino acid
residues, respectively. The N-terminal domain of the proteins predicted
from these genes was particularly well conserved in all five bacteria.
Moreover, by aligning the nucleotide sequences of the upstream region
of the gene, the Shine-Dalgarno sequence, mRNA start site, and
10 and
35 regions identified in E. coli were found to be
perfectly conserved in all the bacteria except for K. pneumoniae, in which the degree of conservation was lower (Fig.
7B). These data suggest not only that each of the four bacteria harbors
a gene identical to E. coli sra but that it is transcribed
in a fashion identical to that found in E. coli.
|
| |
DISCUSSION |
|---|
|
|
|---|
In this paper, we have presented evidence indicating that the ribosome of E. coli contains a protein of unknown function, termed SRA, whose copy number increases in the stationary phase of growth. The relative copy number of the SRA protein remained constant throughout the ribosome purification steps, including washing with high concentrations of salts (Fig. 1). In addition, the protein bound exclusively to the 30S subunit in an in vitro simultaneous reconstitution experiment with both ribosomal subunits (39). Also, the protein was not detected in a free form in the supernatant after sedimentation of ribosomes by centrifugation. These data suggest that SRA is exclusively associated with ribosomes; hence, ribosomes must be the site of its function. Among the ribosomal proteins identified and characterized so far in various organisms, there are quite a few, including the S1 protein of E. coli, whose copy numbers are rather low. However, the copy number of SRA is even lower than that of S1, especially in the exponential phase of growth although, interestingly, it increases about fourfold during the transition to the stationary phase (Fig. 2). Taking these features into account, we adopted the name SRA.
The increase in the amount of the SRA protein is likely to reflect its unknown physiological role in the stationary phase. However, we were unable to discern any anomalies associated with the sra deletion mutation, not only during exponential growth but also upon prolonged culturing of the mutant. Thus, the precise function of the protein in relation to ribosomes remains to be investigated further.
RMF is highly expressed in the stationary phase and binds to the 50S subunits of 70S ribosomes. RMF plays a role in the dimerization of 70S ribosomes into translationally inactive 100S particles. It is believed that the loss of aminoacyl-tRNA binding is responsible for the reduced translational activity (43). The formation of 100S ribosomes and the levels of expression of RMF and SRA appear to be in parallel with each other over the entire growth cycle of E. coli. Nonetheless, an sra deletion mutant and its parental wild-type strain were indistinguishable from each other in terms of the expression of RMF and the formation of 100S ribosomes.
From the expression profile of sra, its transcription
appears to be dependent on factors that are involved in the regulation of genes active in the stationary phase. Indeed, the
-galactosidase assay of the sra-lacZ operon fusion indicated that the level
of transcription of sra in the rpoS mutant was
only about 30% the wild-type level in the stationary phase (Fig. 4).
In accordance with these results, we observed by Northern analysis that
transcription from the sra promoter was lower in the
rpoS mutant (data not shown). Therefore, the promoter of
sra is partly dependent on sigma S. Furthermore, global
transcriptional regulators, such as FIS, IHF, cAMP, and ppGpp, were
found to positively regulate directly or indirectly the transcription
of sra during the stationary phase, and the region between
455 and
325 bp is likely to be responsible for the action of the
regulators (Fig. 6). The low level of transcription of sra
observed in the exponential phase with the wild-type strain was also
the case with mutants defective in the global regulators mentioned
above (Fig. 4). Therefore, these global regulators do not interfere
with sra expression in the exponential phase.
Various global regulators have been demonstrated to have both upregulatory and down-regulatory effects on genes in E. coli. For instance, the cAMP-cAMP receptor protein (CRP) complex has been implicated as an activator of carbon starvation-responsive genes (32). Various genes, including rpoS and several sigma S-dependent genes, such as bolA, are negatively controlled by cAMP-CRP (20, 21). Other global regulators, such as IHF, H-NS, and FIS, are histone-like DNA-binding proteins with a variety of functions. IHF stimulates the expression of dps in the stationary phase in a sigma S-dependent fashion (2), and the level of IHF increases approximately 10-fold during the transition to the stationary phase. Mutants of hns generally have increased levels of sigma S-controlled genes during exponential growth, and the expression of sigma S is stimulated by a posttranscriptional mechanism in hns mutants (3). Thus, it is known that H-NS is a pleiotropic exponential-phase inhibitor of the expression of many stationary-phase-responsive genes. It is an abundant protein in growing cells, and its concentration further increases upon entry into the stationary phase (9, 36). FIS is a relatively abundant DNA-binding protein found in exponentially growing cells. FIS binds sites upstream of promoters for rRNA and tRNA genes and strongly stimulates their promoter activity (30). The level of ppGpp in cells increases under stringent growth conditions. ppGpp has pleiotropic effects on various genes. In a relA spoT double mutant, which is essentially devoid of ppGpp, the cellular sigma S content is greatly decreased because ppGpp has a positive regulatory action on sigma S (10). Thus, many global regulators, including cAMP, H-NS, IHF, and ppGpp, influence the expression of sigma S, which in turn may regulate the transcription of sra in the stationary phase. However, details of the mechanisms of fine control of sra expression in the exponential phase as well as in the stationary phase by sigma S, OmpR, FIS, IHF, cAMP, and/or ppGpp remain to be investigated further.
A search for sra homologs in other organisms in the nucleotide databases revealed the presence of homologous genes in Salmonella serovar Typhimurium and three other enterobacteria (Fig. 7). However, no homologous genes could be found in gram-positive bacteria such as Bacillus subtilis, in spite of extensive searches with different search options (K. Isono and N. Ogasawara, personal communication). This result suggests that the sra gene is likely to be specific to gram-negative, most likely enteric, bacteria. Knowing that its copy number increases in the stationary phase, we are interested in establishing the function of SRA in association with ribosomes, particularly in the stationary phase of growth of E. coli and other enteric bacteria. Perhaps SRA plays a role in cells survival under unfavorable environmental conditions upon prolonged culturing.
| |
ACKNOWLEDGMENTS |
|---|
We are grateful to K. Isono for critical reading of the manuscript and helpful discussions. We also thank H. Inokuchi and A. Ishihama for helpful discussions; M. Ueta and M. Kanemori for laboratory supplies; and C. G. Kurland, A. F. Stewart, Y. Akiyama, Y. Kano, T. Katayama, K. Ikehara, and A. Nishimura for gifts of plasmids and bacterial strains.
This work was supported in part by grants awarded to A. Wada and C. Wada from the Ministry of Education, Science and Culture, Japan.
| |
FOOTNOTES |
|---|
Present address: National Institute for Basic Biology, Okazaki
444-8585, Japan.
Present address: Bioscience Center, Nagoya University, Nagoya
464-8601, Japan.
* Corresponding author. Present address: Department of Physics, Osaka Medical College, 2-41, Sawaragi-Cho, Takatsuki 569-0084, Japan. Phone: 81-726-75-6905. Fax: 81-726-74-6033. E-mail: phy003{at}art.osaka-med.ac.jp.
| |
REFERENCES |
|---|
|
|
|---|
| 1. | Akiyama, Y., and K. Ito. 1985. The SecY membrane component of the bacterial protein export machinery: analysis by new electrophoretic methods for integral membrane proteins. EMBO J. 4:3351-3356[Medline]. |
| 2. | Altuvia, S., M. Almiron, G. Huisman, R. Kolter, and G. Storz. 1994. The dps promoter is activated by OxyR during growth and by IHF and sigma S in stationary phase. Mol. Microbiol. 13:265-272[Medline]. |
| 3. |
Barth, M.,
C. Marschall,
A. Muffler,
D. Fischer, and R. Hengge-Aronins.
1995.
Role for the histone-like protein H-NS in growth-phase-dependent and osmotic regulation of S and many S-dependent genes in Escherichia coli.
J. Bacteriol.
177:3455-3464 |
| 4. |
Bates, D. B.,
E. Boye,
T. Asai, and T. Kogoma.
1997.
The absence of effect of gid or mioC transcription on the initiation of chromosomal replication in Escherichia coli.
Proc. Natl. Acad. Sci. USA
94:12497-12502 |
| 5. | Berman, M. L., L. W. Enquist, and T. J. Silhavy. 1981. Advanced bacterial genetics. Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y. |
| 6. |
Blattner, F. R.,
G. Plunkett III,
C. A. Bloch,
N. T. Perna,
V. Burland,
M. Riley,
J. Collado-Vides,
J. D. Glasner,
C. K. Rode,
G. F. Mayhew,
J. Gregor,
N. W. Davis,
H. A. Kirkpatrick,
M. A. Goeden,
D. J. Rose,
B. Mau, and Y. Shao.
1997.
The complete sequence of Escherichia coli K-12.
Science
277:1453-1474 |
| 7. | Casadaban, M. J. 1976. Transposition and fusion of the lac genes to selected promoters in Escherichia coli using bacteriophage lambda and Mu. J. Mol. Biol. 104:541-555[CrossRef][Medline]. |
| 8. |
Cerretti, D. P.,
D. Dean,
G. R. Davis,
D. M. Bedwell, and M. Nomura.
1983.
The spc ribosomal protein operon of Escherichia coli: sequence and cotranscription of the ribosomal protein genes and a protein export gene.
Nucleic Acids Res.
11:2599-2616 |
| 9. | Dersch, P., K. Schmidt, and E. Bremer. 1993. Synthesis of the Escherichia coli K-12 nucleoid-associated DNA-binding protein H-NS is subjected to growth phase control and autoregulation. Mol. Microbiol. 8:875-889[Medline]. |
| 10. |
Gentry, D. R.,
V. J. Hernandez,
L. H. Nguyen,
D. B. Jensen, and M. Cashel.
1993.
Synthesis of the stationary-phase sigma factor sigma S is positively regulated by ppGpp.
J. Bacteriol.
175:7982-7989 |
| 11. | Goshima, N., Y. Kano, H. Tanaka, K. Kohno, T. Iwaki, and F. Imamoto. 1994. IHF suppresses the inhibitory effect of H-NS on HU function in the hin inversion system. Gene 141:17-23[CrossRef][Medline]. |
| 12. | Guyer, M. S., R. R. Reed, J. A. Steitz, and K. B. Low. 1981. Identification of a sex-factor-affinity site in E. coli as gamma delta. Cold Spring Harb. Symp. Quant. Biol. 45:135-140. |
| 13. | Hardy, S. J. S., C. G. Kurland, P. Voynow, and G. Mora. 1969. The ribosomal proteins of Escherichia coli. I. Purification of the 30S ribosomal proteins. Biochemistry 8:2897-2905[CrossRef][Medline]. |
| 14. | Hengge-Aronis, R. 1996. Regulation of gene expression during entry into stationary phase, p. 1497-1512. In F. C. Neidhardt, et al. (ed.), Escherichia coli and Salmonella: cellular and molecular biology, 2nd ed. ASM, Press, Washington, D.C. |
| 15. | Hirano, M., K. Shigesada, and M. Imai. 1987. Construction and characterization of plasmid and lambda phage vector systems for study of transcriptional control of Escherichia coli. Gene 57:89-99[CrossRef][Medline]. |
| 16. | Horie, K., A. Wada, and H. Fukutome. 1981. Conformational studies of Escherichia coli ribosomes with the use of acridine orange as a probe. J. Biochem. 60:449-461. |
| 17. | Kaltschmidt, E., and H. G. Wittman. 1970. Ribosomal proteins. VII. Two-dimensional polyacrylamide gel electrophoresis for fingerprinting of ribosomal proteins. Anal. Biochem. 36:401-412[CrossRef][Medline]. |
| 18. |
Kitagawa, M.,
C. Wada,
S. Yoshioka, and T. Yura.
1991.
Expression of ClpB, an analog of the ATP-dependent protease regulatory subunit in Escherichia coli, is controlled by a heat shock sigma factor (sigma 32).
J. Bacteriol.
173:4247-4253 |
| 19. | Kohara, Y., K. Akiyama, and K. Isono. 1987. The physical map of the whole E. coli chromosome: application of a new strategy for rapid analysis and sorting of a large genome library. Cell 50:495-508[CrossRef][Medline]. |
| 20. |
Lange, R., and R. Hengge-Aronis.
1991.
Growth-phase-regulated expression of bolA and morphology of stationary-phase Escherichia coli cells are controlled by the novel sigma factor sigma S.
J. Bacteriol.
173:4474-4481 |
| 21. |
Lange, R., and R. Hengge-Aronis.
1994.
The cellular concentration of the sigma S subunit of RNA polymerase in Escherichia coli is controlled at the levels of transcription, translation, and protein stability.
Genes Dev.
8:1600-1612 |
| 22. |
Loewen, P. C., and B. L. Triggs.
1984.
Genetic mapping of katF, a locus that with katE affects the synthesis of a second catalase species in Escherichia coli.
J. Bacteriol.
160:668-675 |
| 23. | Mahajan, S. K., C. C. Chu, D. K. Willis, A. Templin, and A. J. Clark. 1990. Physical analysis of spontaneous and mutagen-induced mutants of Escherichia coli K-12 expressing DNA exonuclease VIII activity. Genetics 125:261-273[Abstract]. |
| 24. | Maniatis, T., E. F. Fritsch, and J. Sambrook. 1982. Molecular cloning: a laboratory manual. Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y. |
| 25. |
Matsunaga, F.,
Y. Kawasaki,
M. Ishiai,
K. Nishikawa,
T. Yura, and C. Wada.
1995.
DNA-binding domain of the RepE initiator protein of the mini-F plasmid: involvement of the carboxyl-terminal region.
J. Bacteriol.
177:1994-2001 |
| 26. |
Mayaux, J.-F.,
G. Fayat,
M. Fromant,
M. Springer,
M. Grunberg-Manago, and S. Blanquet.
1983.
Structural and transcriptional evidence for related thrS and infC expression.
Proc. Natl. Acad. Sci. USA
80:6152-6156 |
| 27. | Miller, H. I. 1984. Primary structure of the himA gene of Escherichia coli: homology with DNA-binding protein HU and association with the phenylalanyl-tRNA synthetase operon. Cold Spring Harbor Symp. Quant. Biol. 49:691-698[Medline]. |
| 28. | Miller, J. H. 1972. Experiments in molecular genetics, p. 352-355. Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y. |
| 29. | Noll, M., B. Hapke, M. H. Schreire, and H. Noll. 1973. Structural dynamics of bacterial ribosomes. I. Characterization of vacant couples and their relation to complexed ribosomes. J. Mol. Biol. 75:281-294[CrossRef][Medline]. |
| 30. | Rao, L., W. Ross, J. A. Appleman, T. Gaal, S. Leirmo, P. J. Schlax, M. T. Record, Jr., and R. L. Gourse. 1994. Factor independent activation of rrnB P1. An "extended" promoter with an upstream element that dramatically increases promoter strength. J. Mol. Biol. 235:1421-1435[CrossRef][Medline]. |
| 31. | Sacerdot, C., G. Fayat, P. Dessen, M. Springer, and S. Blanquet. 1982. Sequence of a 1.26-kb DNA fragment containing the structural gene for E. coli initiation factor IF3: presence of an AUU initiator codon. EMBO J. 1:311-315[Medline]. |
| 32. |
Schultz, J. E.,
G. I. Latter, and A. Martin.
1988.
Differential regulation by cyclic AMP of starvation protein synthesis in Escherichia coli.
J. Bacteriol.
170:3903-3909 |
| 33. | Thang, M. N., D. C. Thang, and M. Grunberg-Manago. 1967. An altered polynucleotide phosphorylase in E. coli mutant Q13. Biochem. Biophys. Res. Commun. 28:374-379[CrossRef][Medline]. |
| 34. | Traub, P., and M. Nomura. 1968. Structure and function of Escherichia coli ribosomes. I. Partial fractionation of the functionally active ribosomal proteins and reconstitution of artificial subribosomal particles. J. Mol. Biol. 34:575-593[CrossRef][Medline]. |
| 35. | Triezenberg, S. J. 1992. Primer extension, p. 4.8.1-4.8.5. In Current protocols in molecular biology. John Wiley & Sons, Inc., New York, N.Y. |
| 36. | Ueguchi, C., M. Kakeda, and T. Mizuno. 1993. Autoregulatory expression of the Escherichia coli hns gene encoding a nucleoid protein: H-NS functions as a repressor of its own transcription. Mol. Gen. Genet. 236:171-178[CrossRef][Medline]. |
| 37. |
Vogel, H. J., and D. M. Bonner.
1956.
Acetylornithinase of Escherichia coli: partial purification and some properties.
J. Biol. Chem.
218:97-106 |
| 38. |
Wada, A.
1986.
Analysis of Escherichia coli ribosomal proteins by an improved two dimensional gel electrophoresis. I. Detection of four new proteins.
J. Biochem.
100:1583-1594 |
| 39. |
Wada, A.
1986.
Analysis of Escherichia coli ribosomal proteins by an improved two dimensional gel electrophoresis. II. Characterization of four new proteins.
J. Biochem.
100:1595-1605 |
| 40. |
Wada, A., and T. Sako.
1987.
Primary structures of and genes for new ribosomal proteins A and B in Escherichia coli.
J. Biochem.
101:817-820 |
| 41. |
Wada, A.,
Y. Yamazaki,
N. Fujita, and A. Ishihama.
1990.
Structure and probable genetic location of a "ribosome modulation factor" associated with 100S ribosomes in stationary-phase Escherichia coli cells.
Proc. Natl. Acad. Sci. USA
87:2657-2661 |
| 42. | Wada, A., K. Koyama, Y. Maki, Y. Shimoi, A. Tanaka, and H. Tsujii. 1993. A 5 kDa protein (SCS23) from the 30S subunit of the spinach chloroplast ribosome. FEBS Lett. 319:115-118[CrossRef][Medline]. |
| 43. | Wada, A., K. Igarashi, S. Yoshimura, S. Aimoto, and A. Ishihama. 1995. Ribosome modulation factor stationary growth phase-specific inhibitor of ribosome functions from Escherichia coli. Biochem. Biophys. Res. Commun. 214:410-417[CrossRef][Medline]. |
| 44. | Wittmann, H. G. 1974. Two-dimensional polyacrylamide gel electrophoresis for separation of ribosomal proteins. Methods Enzymol. 30:497-505[Medline]. |
| 45. | Wittmann, H. G., G. Stofflet, I. Hindennach, C. G. Kurland, E. A. Birge, L. Randall-Hazelbauer, M. Nomura, E. Kaltschmidt, S. Mizushima, R. R. Traut, and T. A. Bickle. 1971. Correlation of 30S ribosomal proteins of Escherichia coli isolated in different laboratories. Mol. Gen. Genet. 111:327-333[CrossRef][Medline]. |
| 46. | Wittmann, H. G., J. A. Littlechild, and B. Wittmann-Liebold. 1980. Structure of ribosomal proteins, p. 51-88. In G. Chambliss, G. R. Craven, J. Davies, K. Davies, L. Kahan, and M. Nomura (ed.), Ribosomes: structure, function and genetics. University Park Press, Baltimore, Md. |
| 47. |
Xiao, H.,
M. Kalma,
K. Ikehara,
S. Zemel,
G. Glaser, and M. Cashel.
1991.
Residual guanosine 3',5'-bispyrophosphate synthetic activity of relA null mutants can be eliminated by spoT null mutations.
J. Biol. Chem.
266:5980-5990 |
| 48. | Yamada, H., T. Yoshida, K. Tanaka, C. Sasakawa, and T. Mizuno. 1991. Molecular analysis of the Escherichia coli hns gene encoding a DNA-binding protein, which preferentially recognizes curved DNA sequences. Mol. Gen. Genet. 230:332-336[CrossRef][Medline]. |
| 49. | Yamagishi, M., H. Matsushima, A. Wada, M. Sakagami, N. Fujita, and A. Ishihama. 1993. Regulation of the Escherichia coli rmf gene encoding the ribosome modulation factor: growth phase- and growth rate-dependent control. EMBO J. 12:625-630[Medline]. |
| 50. | Yano, R., M. Imai, and T. Yura. 1987. The use of operon fusions in studies of the heat-shock response: effects of altered sigma 32 on heat-shock promoter function in Escherichia coli. Mol. Gen. Genet. 207:24-28[CrossRef][Medline]. |
| 51. | Zhang, Y., F. Buchholz, J. P. Muyrers, and A. F. Stewart. 1998. A new logic for DNA engineering using recombination in Escherichia coli. Nat. Genet. 20:123-128[CrossRef][Medline]. |
This article has been cited by other articles:
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Appl. Environ. Microbiol. | Infect. Immun. | Eukaryot. Cell |
|---|---|---|
| Mol. Cell. Biol. | J. Virol. | Microbiol. Mol. Biol. Rev. |
| ALL ASM JOURNALS |