Previous Article | Next Article ![]()
Journal of Bacteriology, March 2007, p. 2039-2045, Vol. 189, No. 5
0021-9193/07/$08.00+0 doi:10.1128/JB.01454-06
Copyright © 2007, American Society for Microbiology. All Rights Reserved.

Department of Molecular Biology, Tokyo University of Pharmacy and Life Science, 1432-1 Horinouchi, Hachioji, Tokyo 192-0392,1 Department of Bioscience and Bioinformatics, Faculty of Computer Science and Systems Engineering, Kyushu Institute of Technology, 680-4, Ooaza-kawazu, Iizuka, Fukuoka, 820-8502,2 Department of Biological Sciences, Graduate School of Science, Tokyo Metropolitan University, 1-1 Minami-osawa, Hachioji, Tokyo 192-0397, Japan3
Received 14 September 2006/ Accepted 14 December 2006
|
|
|---|
|
|
|---|
Eukaryotic cells contain complex intracellular membranous structures and are usually larger and more complex than prokaryotic cells. Several models have been proposed to explain the evolution of the complex eukaryotic cell, including fusion, intrusion, or symbiosis of two or more prokaryotic cells, i.e., archaea and bacteria (5, 8, 10, 19, 20, 21, 22, 24, 39).
In addition to the evolutionary origin of eukaryotic cellular structures, the origins of eukaryote-specific components, including the cytoskeleton, have generated a great deal of interest. Although the cytoskeleton is considered to be eukaryote specific, homology between tubulin, a component of the microtubule, and the bacterial counterpart FtsZ, which participates in division ring formation, has been reported (2).
Actin is a principal element of the eukaryotic cytoskeleton. Monomeric actin has a molecular mass of about 43 kDa and can polymerize to form F-actin, which comprises two protofilaments that form a right-handed double helix (6, 13, 23, 29). Actin can form various types of polymer depending on the conditions (1, 9). Actin homologs, encoded by mreB genes, are conserved among rod-shaped, filamentous, and helical bacteria, suggesting that MreB protein is important for generating a nonspherical shape in bacteria (15). van den Ent et al. have reported the X-ray crystallographic structure of the actin homolog MreB from the thermophilic bacterium Thermotoga maritima (35). Despite a very weak sequence similarity between actin and MreB (
15%), the structural similarity of these two proteins is striking. MreB and its close relative Mbl are important in regulating the cell shape of Bacillus subtilis (15). The possible involvement of MreB in the cytoskeletal structure of another bacterium, Spiroplasma melliferum, has also been postulated (17).
Recently, the structure of the archaeal actin homolog Ta0583, from T. acidophilum, was reported by Roeben et al. (25). Ta0583 displays significant structural homology to actin, MreB, and ParM. Interestingly, Ta0583 is able to hydrolyze GTP, UTP, and CTP as well as ATP. In this report, we analyzed the polymerization characteristics of Ta0583 from T. acidophilum. Our results suggest that eukaryotic actin displays a greater resemblance to Ta0583 than to bacterial MreB and ParM.
|
|
|---|
|
View this table: [in a new window] |
TABLE 1. Protein sequences used for phylogenetic analysis
|
The gene encoding MreB homolog Ta0583 (27) (GenBank accession number NP_394057) in T. acidophilum was amplified from genomic DNA by PCR with primers ATGGTAGTTGTAGGATTGGATG and TTATCTACATCGATCTTTCCGC. The amplified DNA fragment was cloned into the TA expression vector pCRT7/NT-TOPO, in which 35 residues (MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDPTL), including a hexahistidine tag, originating from the vector were added to the N terminus. Mutation A (Trp37Glu and Lys42Glu) and mutation AB (Trp37Glu, Lys42Glu, Arg271Glu, and Met326Asp) were introduced into Ta0583 using mutagenic primers TTGATAAGGATCCAACCCTTATG and CTGTGCTGAGGACGGGTATTTCTCCGCCTATACCTTCGCTCTCGGTCTCCGTCAC for mutation A and mutagenic primers GAGAACATAAGGCTGAACCTCGAAGGAGAGGTTGACAGGGTTACTTCTCTGATACCAGTAGGGGGAGGGTCCAACCTGATAGGAGACCG and TCCGGATCAAGCTTCGAATTCTCGCCCTTTTATTAGTCCGATCTTTCCGCCGCATCC for mutation AB (mutation sites are underlined). The protein was expressed in Escherichia coli BL21RIL(DE3) cells, grown at 37°C in LB medium. The induced cells were harvested after 16 h of cultivation and lysed by sonication in a buffer containing 100 mM Tris-HCl (pH 8.0), 500 mM NaCl, and 5 mM imidazole. The lysate was then incubated at 60°C for 10 min. After centrifugation (5,000 x g, 10 min), the supernatant was applied to a Ni2+-nitrilotriacetic acid column (Amersham Biosciences, Piscataway, NJ). The column was washed with a buffer containing 20 mM Tris-HCl (pH 8.0), 500 mM NaCl, and 60 mM imidazole, and bound protein was then eluted with a buffer containing 20 mM Tris-HCl (pH 8.0), 500 mM NaCl, and 1 M imidazole. The eluate was dialyzed against 20 mM Tris-HCl (pH 8.0) and stored at 4°C. The purity of the preparation was confirmed by sodium dodecyl sulfate-polyacrylamide gel electrophoresis. The protein concentration was estimated by the bicinchoninic acid method.
Light-scattering measurements.
Polymerization of Ta0583 was monitored by right-angle light scattering in a Shimadzu (Kyoto, Japan) RF-5300PC fluorometer at 340 nm. The standard polymerization buffer contained 50 mM sodium acetate (pH 5.5), 4 mM MgCl2, and 4 mM ATP. Ta0583 was added to the buffer (final concentration, 0.1 mg ml1) in a 1-cm-path-length cell maintained at 56°C. The mixture was stirred rapidly with a plastic stick, and light scattering was monitored. To test the pH dependence, 50 mM sodium acetate (pH 4.0 to 5.0) or 50 mM morpholineethanesulfonic acid (MES; pH 6.0) was used in place of sodium acetate (pH 5.5). To test the effect of monovalent cations, 0.1 to 200 mM NaCl or KCl was added. To test the effect of divalent cations, 0 to 1 mM MgCl2/CaCl2 plus 1 mM EGTA was added. Alternatively, 1 to 50 mM MgCl2/CaCl2 was added in place of 4 mM MgCl2. To test the effect of nucleotides, 4 mM nucleotide (GTP, CTP, UTP, dATP, dGTP, dCTP, dUTP, dTTP, ADP, GDP, CDP, or UDP) was added in place of 4 mM ATP. To test the effect of adenosine 5'-(ß,
-imido)triphosphate (AMP-PNP), 4 mM AMP-PNP was added in place of 4 mM ATP. Alternatively, 4 or 8 mM AMP-PNP was added in addition to 4 mM ATP. To test repolymerization, Ta0583 filament (polymerized in standard polymerization buffer at 56°C for 10 min) was placed at 0 or 56°C for 1 h. Polymerization was then measured using the light-scattering assay at 56°C. To determine the critical concentration of Ta0583 for polymerization, the light-scattering intensity was plotted as a function of the total concentration of Ta0583 in solution, and the plot was extrapolated to zero intensity.
Precipitation assay. Ta0583 (0.5 mg ml1) was polymerized in the standard buffer with or without ATP at 56°C for 5 min. Ta0583 fiber was centrifuged (at 10,000 x g for 10 min at 25°C), and the supernatant and pellet were analyzed by sodium dodecyl sulfate-polyacrylamide gel electrophoresis. To test the effect of nucleotides, 4 mM nucleoside triphosphate (NTP) (ATP, UTP, CTP, or GTP) was added in place of 4 mM ATP.
Electron microscopy. One milligram of Ta0583 per milliliter in the standard polymerization buffer was incubated at 25°C for 5 min (see Fig. 3A and B), or 0.1 mg ml1 Ta0583 in buffer (50 mM sodium acetate [pH 5.0], 4 mM MgCl2, 0.1 mM CaCl2, and 4 mM ATP) was incubated at 56°C for 5 min (see Fig. 3C). Then 5 µl of the Ta0583 solution was placed on a Formvar-coated copper electron microscopic grid. Excess liquid was blotted, and the grid was washed with a drop of water. The grids were stained with 1.5% uranyl acetate solution, dried, and observed with a JEM-1010 electron microscope (JEOL, Tokyo, Japan). The images were digitized using a line scanner (Leafscan45; Scitex, Herzliya, Israel) at a pixel size of 5 µm, whose contrast transfer function was compensated. Fourier diffraction patterns were computed from the electron micrographs. All images were analyzed with the Eos package as reported previously (38).
![]() View larger version (87K): [in a new window] |
FIG. 3. (A to C) Electron micrographs of the negatively stained Ta0583 bundle structure. (A) Typical view of bundle of Ta0583 fibers; (B) branched bundle; (C) filament with shortest width (0.1 mg ml1). Bars, 10 nm. (D) Computed Fourier transform of Ta0583 fiber. Yellow circles indicate diffraction spots due to layered lines. (E) Polymerization model of T. maritima MreB. Shown is a contact site of MreB fiber. Orange arrows, A mutation points; purple arrows, B mutation points. Cyan, yellow, magenta, and green, domains 1, 2, 3, and 4, respectively.
|
|
|
|---|
![]() View larger version (37K): [in a new window] |
FIG. 1. Maximum-likelihood tree of actin and MreB homologs rooted by the heat shock protein hsp70. The internal mode indicated by a star has a bootstrap value of 0.766 for monophyly of group A MreB homologs and eukaryotic actin. Archaeal homologs are shown against a green background. Group A and B homologs are surrounded by red and blue lines, respectively. Standard bar represents 0.1 nucleotide change per site. See Table 1 for accession numbers of the sequences used.
|
![]() View larger version (43K): [in a new window] |
FIG. 2. Polymerization of Ta0583 monitored by light scattering. (A) pH dependence. The light-scattering intensity (LSI) is expressed as a percentage of that attained after 10 min under standard conditions. Colors represent pH values as follows: red, pH 4.0; orange, pH 4.5; yellow, pH 5.0; green, pH 5.5; blue, pH 6.0. (B) Temperature dependence. Red, 65°C; orange, 56°C; yellow, 45°C; green, 35°C; sky blue, 25°C; blue, 15°C; purple, 5°C. (C) Effects of cations on the level of polymerization. Yellow, MgCl2; green, CaCl2; red, NaCl; orange, KCl. (D) ATP concentration dependence. Red diamonds, levels (expressed as percentages) attained at 10 min; orange rectangles, increasing rate (per minute). (E) Depolymerization and repolymerization experiment. Initial polymerization (red) was done under standard conditions. After attainment of the plateau, one sample was chilled on ice for 1 h, while another was kept at 56°C; both samples were then incubated again at 56°C. Orange and yellow, second measurements after incubation at 0 and 56°C, respectively. (F) Polymerization activities of Ta0583 mutants. Red, wild type; orange, mutant A; yellow, mutant AB. (G) Protein concentration dependence of LSI. LSI at 10 min after polymerization is plotted against Ta0583 concentration.
|
Figure 2B shows the temperature dependence of polymerization. The plateau level increased with increasing temperature up to 56°C. This finding is compatible with the fact that the optimal growth temperature of T. acidophilum is around 60°C.
Mg2+ was required for polymerization (Fig. 2C), and 4 mM MgCl2 was sufficient to enhance the polymerization. However, higher concentrations of MgCl2 suppressed polymerization, with half suppression by about 18 mM. Polymerization was also suppressed by addition of NaCl, KCl, or CaCl2, with half suppression by about 100 mM, 10 mM, and 18 mM, respectively.
Actin polymerization depends specifically on ATP, whereas polymerization of T. maritima MreB was supported by both ATP and GTP. We found that the polymerization of Ta0583 requires NTP and is optimal at a concentration of about 4 mM ATP (Fig. 2D). The ATP-dependent polymerization of Ta0583 was also confirmed by precipitation analysis (Fig. 4). Ta0583 polymerization was found to be supported not only by ATP and GTP but also by UTP and CTP (Fig. 4; Table 2). The low specificity of Ta0583 for NTPs is consistent with a previous study by Roeben et al. (25), which reported the hydrolysis of GTP, CTP, and UTP as well as ATP. However, even the deoxy form of NTP could support the polymerization reaction (Table 2). This low specificity for NTP species suggests that Ta0583 retains primitive characteristics of ancestral actin. Low specificity is often associated with antiquity of enzymes (14).
![]() View larger version (21K): [in a new window] |
FIG. 4. Precipitation analysis of Ta0583. Shown are the Ta0583 bands in the supernatant (sup) and the precipitate (ppt) after centrifugation (at 10,000 x g for 10 min at 25°C) and the input sample (no centrifugation) after polymerization of 0.5 mg ml1 Ta0583 under standard conditions with ATP, UTP, CTP, or GTP or without NTPs for 5 min. The Ta0583 band corresponds to a molecular mass of 39 kDa, which is consistent with the gene sequence.
|
|
View this table: [in a new window] |
TABLE 2. Effects of NTPs on the polymerization of Ta0583
|
The polymerization reaction was accelerated at higher temperatures up to a maximum of 65°C. Not only was the polymerization reaction suppressed by low temperatures, but the polymerized Ta0583 was depolymerized when the polymer was placed at 0°C (Fig. 2E). In this experiment, Ta0583 polymerized under standard conditions was placed at 0°C for 1 h. Then the solution was placed in the cell folder maintained at 56°C. The initial level of the light scattering was as low as the level before polymerization and was followed by an increase in scattering. The depolymerization at 0°C cannot be attributed to the consumption of ATP, because the high level of scattering was observed when the mixture was maintained at 56°C for 1 h after the polymerization reaction under standard conditions.
A 3-dimensional model of polymerized MreB has recently been postulated (35). Based on the model (Fig. 3E), we designed mutations that were anticipated to inhibit the polymerization reaction. We introduced negative charges into domain 2, in Ta0583 mutant A (Fig. 3E). Additional negative charges were introduced into domains 1 and 3, which were expected to interact with domains 2 and 4 of the neighboring subunit, respectively (Fig. 3E), in Ta0583 mutant AB. Polymerization was half inhibited in mutant A and totally abolished in mutant AB (Fig. 2F). These results suggest that Ta0583 has subunit interactions similar to those of actin and T. maritima MreB in the fibrous structure and that domains 2 and 1 or 3 in Ta0583 are also responsible for the polymerization. Our results are consistent with the intersubunit interactions found in the crystal structure of Ta0583 (25), as described in the Discussion.
Polymerization of eukaryotic actin is accelerated by phalloidin and inhibited by cytochalasin D (3). However, the polymerization of Ta0583 was unaffected by both phalloidin and cytochalasin D, at least up to 10 µM (Table 3).
|
View this table: [in a new window] |
TABLE 3. Effects of compounds on the polymerization of Ta0583
|
Electron microscopy. We used electron microscopy to examine negatively stained bundles of Ta0583 fibers. Figure 3A shows a typical bundle of fibers observed in the Ta0583 sample under standard polymerizing conditions at 25°C. The structure of the bundle resembles the paracrystalline structure of actin formed at high concentrations of KCl (1). The total width of the bundle ranged from 14 nm to more than 1.5 µm (Fig. 3A), with frequent branching (Fig. 3B).
Figure 3C shows a typical view of the narrowest fiber in which a partial helical structure could be observed. Each protofilament in the Ta0583 bundle had a width of about 5.6 nm (5.6 ± 1.0 nm). A subunit-like structure of about 5.0 nm (5.0 ± 1.0 nm) in the axial direction was also seen in some parts of the bundle (Fig. 3C). The repeating unit was analyzed by Fourier transformation of electron micrographs (Fig. 3D). The equatorial and meridian spots indicate the transversal and longitudinal repeats of monomers within Ta0583 fiber. The repeating unit of
5.5 nm by
5.5 nm was obtained by diffraction analysis (Fig. 3D). The Fourier pattern also indicated the existence of a helical structure, as indicated by some off-meridian/diagonal spots. The off-meridian/diagonal spots indicate the twisting of the fibers like an actin filament.
|
|
|---|
We found that Ta0583, which shows sequence homology to eukaryotic actin, polymerizes to form bundles. The polymerization of Ta0583, monitored by light scattering, was found to be optimal at pH 4.5 to 5.5. Intriguingly, this pH range is similar to the intracellular pH of T. acidophilum (i.e., pH 5.5) (30). The polymerization reaction accelerated with increasing temperature up to a maximum at 56°C, which is consistent with the optimal growth temperature of T. acidophilum, about 60°C. Several other characteristics of Ta0583 are summarized in Table 4 together with those of its eukaryotic and bacterial counterparts. The effects of MgCl2 on Ta0583 are similar to the effects of this salt on eukaryotic actin, though the optimal concentrations are different: 4 mM for Ta0583 and 2 mM for actin (23). MgCl2 has been reported to suppress the polymerization of MreB from the bacterium T. maritima (7, 35).
|
View this table: [in a new window] |
TABLE 4. Comparison of actin homologs
|
Roeben et al. have analyzed the 3-dimensional structure of Ta0583 (25). They also reported that Ta0583 forms sheets with spacing resembling the crystal lattice in vitro, indicating an inherent propensity to form a filamentous structure. The fold of Ta0583 contains the core structure of actin and clearly belongs to the actin/hsp70 superfamily of ATPases. Based on these findings, Ta0583 is approximately equidistant from actin and MreB at the structural level and combines features from both eubacterial actin homologs, MreB and ParM (25). However, Roeben et al. did not report the ATP- or GTP-dependent polymerization of Ta0583 (25).
Our results are similar to those of Roeben et al. in the sense that Ta0583 can form (para)crystalline structures, although there are significant discrepancies. Specifically, Roeben et al. have not reported nucleotide-dependent polymerization, while our observations show that ATP or GTP can induce Ta0583 polymerization. These discrepancies may be attributed to different conditions used for the polymerization analysis. For example, Roeben et al. used a more neutral pH (pH 6.8) and a higher MgCl2 concentration (10 mM), both of which are inhibitory to the polymerization reaction, for their experiments.
Roeben et al. reported that Glu35, Ile43, and Asp275 are protofilament contacts in the Ta0583 crystal sheet (25). Our mutation analysis is compatible with the protofilament contact reported by Roeben et al. (25). In the structure reported by Roeben et al., charged residues could be located near the introduced charged residues. The distance between the mutated residue Lys42Glu and Asp191 is 10.71 Å, and the distance between Lys42Glu and Glu193 is 12.04 Å in mutant A (Fig. 5A). The distance between mutated residue Arg271Glu and Glu232 is 22.61 Å in mutant AB (Fig. 5B). These negatively charged residues are anticipated to cause electrostatic repulsion in the known structure of Ta0583.
![]() View larger version (46K): [in a new window] |
FIG. 5. Contact site of Ta0583. This figure was made by residue replacement from the Ta0583 crystal structure (25) (Protein Data Bank accession number 2fsj) with PyMOL. Original contact sites are shown in purple. (A) Lys42Glu in mutant A (red) and Asp191/Glu193 in the neighboring subunit. (B) Arg271Glu in mutant AB (red) and Glu232 in the neighboring subunit.
|
Because T. acidophilum lacks a cell wall, the cytoplasmic membrane is directly exposed to the surrounding milieu. A simple liposomal structure made up of a lipid membrane is expected to form a spherical structure. However, although the overall shape of the cells can be quite variable, they rarely form simple rod or spherical structures (12). Accordingly, the presence of a cytoskeleton in T. acidophilum has been postulated (12). Hixon and Searcy reported a superprecipitation reaction of the cell extract of T. acidophilum (12). The cell extract is superprecipitated by adding calcium and ATP, and the reaction is inhibited by EGTA. These results suggested the presence of an actin-like component in the cells of T. acidophilum. Ta0583, reported here, may represent the actin-like component postulated by Searcy a few decades ago (31). However, the cation dependence of superprecipitation is different from the cation dependence of Ta0583. This observation suggests that there may be additional components responsible for the superprecipitation.
Searcy also reported that T. acidophilum cells become spherical at low temperatures, suggesting depolymerization of the internal structure (31). The depolymerization of Ta0583 detected at low temperatures in our study is compatible with these observations and suggests that Ta0583 is involved in the formation of an internal structure that alters cell morphology. However, Roeben et al. (25) have reported that the content of Ta0583 (0.04%) in T. acidophilum cells is lower than that of eukaryotic actin in eukaryotic cells (
8%), and the amount may not be sufficient to maintain the structure. Accordingly, components other than Ta0583 may be involved in maintaining cellular structure. Alternatively, expression of Ta0583 in T. acidophilum cells may vary depending on the precise environmental conditions (25).
Polymerization of actin and bacterial MreB is specific to ATP and ATP/GTP, respectively. However, the polymerization of Ta0583 showed very little specificity to ribo- and deoxyribonucleotides (Fig. 4; Table 2). Low specificity for substrates of ancient forms of enzymes has been postulated (14). The low nucleotide specificity found in Ta0583 may represent the ancient characteristics of eukaryotic actin.
There are several models of the evolution of eukaryotic cells (5, 8, 10, 19, 20, 21, 22, 24, 39). However, the ancestor or origin of the eukaryotic nucleus is still unclear. T. acidophilum has been proposed as a host of endosymbiotic origin of eukaryotic cells (20). A phylogenetic tree constructed from small rRNA sequences suggests that different archaeal species are all equally related to eukaryotes and that none of them has a special relationship to the ancestor of eukaryotic cells (39). However, the closest relatives of particular eukaryotic components are often found in different species of Archaea, depending on the gene of interest. For example, eukaryotic RNA polymerase resembles its counterparts in Crenarchaeota and in Thermoplasma species more closely than it resembles its homologs in other species of Euryarchaeota (18). The closest relatives of eukaryotic histone have been found in Euryarchaeota, especially in methanogens (28). Our current data suggest that Thermoplasma species, and possibly also Archaeoglobus species, retain the closest relatives of eukaryotic actin (Table 4). Because the other archaeal homologs of MreB are in the same branch as the bacterial homologs (Fig. 1), which are less similar to eukaryotic actin, our data also imply that the common ancestor of eukaryotes and Archaea already possessed a primitive actin.
Published ahead of print on 22 December 2006. ![]()
|
|
|---|
This article has been cited by other articles:
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Copyright © 2009 by the American Society for Microbiology. For an alternate route to Journals.ASM.org, visit: http://intl-journals.asm.org | More Info»