TABLE 2.

Characteristics of the 22 putative LPXTG cell wall-associated proteins

ORFSignal peptide (probability)Cleavage site probabilityC-terminal cell wall sorting sequenceaAccession no.
orf371 Yes (1.000)0.995 LPKTNEKTASVSYSLAGAGVLVAAAYGIIRKKK ZP_00604782
orf418 Yes (1.000)0.976 LPKTGSQSNNWITLAGVILLVIGLRITFMSYKKSKR ZP_00604835
orf773 Yes (0.923)0.853 IPLTGITFPFLSQGGSSLLMLSICVGFVLNISADEKRKSLGL ZP_00604269
orf884 Yes (0.804)0.798 LPKSGESQNKVILWSGII LLSIATMLSAKRFKQNRSL ZP_00603974
orf903 Yes (0.840)0.787 LPSTGGIGLLPFVFLGLIFIFSGFFYFIHRKKKAGEQR ZP_00604460
orf905 No0.000 FPKTSEEMLGGFSILGLLLVLSTGTAWFYKKQQKGNNRREIK ZP_00604462
orf 907 No0.000 LPSTGGMGIIVFILVGTALVGGAVIYFKKRHQETEA ZP_00604464
orf1901 Yes (0.999)0.999 VPKTGSTHLVTISAVSLLLLVLATFSYAVLRYI ZP_00603526
orf1904 Yes (0.999)0.999 VPMTGSNGFQTYVLISCLLLGAGALSAVVYFKKKA ZP_00603529
orf1996 Yes (1.000)0.914 LPKTGEFNNPLLALAGGILLIGVVVYVMKQRKK ZP_00603029
orf2008 Yes (1.000)0.999 LPATGGNGLLAFLLIGISLMIGAYSWYRKSKMKSEV ZP_00603041
orf2009 Yes (0.999)0.797 FPQTNEARTLISLLGILLLLGAVLLIKKERGEKNE ZP_00603042
orf2010 No0.000 LPATGGSGRLFYILLAAFFMALAGAAYGLFVRQSKKEGAR ZP_00603043
orf2109 Yes (0.993)0.512 QPITNTLLEQGQKKLKITAKDTSINITTDQEDNETD ZP_00602865
orf2351 Yes (1.000)0.782 LPETGSRTLNKLITWMGVLLILIVGASYFRSLFHRVK ZP_00602747
orf2356 Yes (0.989)0.938 LPKTGEKKHSLLIYSGGFLSVSTIITWIWRRKRG ZP_00602752
orf2430 Yes (1.000)1.000 FPQTGEKNSNVLLFIGFTLIFATAGYYFWNRRN ZP_00603098
orf2514 Yes (1.000)0.978 LTPGGVVLTKIDDQSGEILQELFLSYRTEKEKRYKPV ZP_00602630
orf2515 No0.000 LPKTGETIISQFILSILGVLLVFISIKFRKKRNI ZP_00602631
orf2569 Yes (1.000)0.997 LPSTGGKGIYVYIGAGVVLLLIAGLYFARRKHSQI ZP_00602687
orf2570 Yes (0.678)0.516 LPKTNETKNTLLGVVGMVFASFAIWLFIKKRTGVKK ZP_00602688
orf2571 Yes (1.000)0.997 LPETGGIGRLGIYLVGMIGCAFSIWYLFLKKERGGS ZP_00602689
  • a The LPXTG-like motifs are depicted in bold, and the positively charged C-terminal amino acids are underlined.