TABLE 2.

Amino acid sequences of putative bacteriocins found in new loci

Peptide locus tagAmino acid sequenceaLength (aa); pIb
Anoxybacillus flavithermus WK1 peptides
    Aflv_2616dMRMFQELNHVELQGIDGG-SWKSHVVNLVGVVSGFGTTGAVIGGSFGGPLGAAAGGFVGAHYGAVAYAIGVLLDSSNRRK61; 9.91
    Aflv_2615dMEGVVFTMELMLEKNGSISFLSEEELKEIDGG-RGSWTNAVIGAGTLSPIVASAVRGAQQGVRFGRLGGPWGVVAGAVVGAVVG58; 10.83
    Aflv_2618MKELKADELVSIDGG-ISACGKVSVAAFAHTAAFTGLMTFAGVSGPVGWVLGTFVGGAWLGASAAAGCLK54; 8.90
Bacillus cereus BDRD-ST26 peptides
    Bcere0013_55840MEELKEFELENIDGG-SWKSHTINVVGNVATYGGIGTAICGPACGVVGAHYGAVAYGVGYLLDNK49; 7.79
    Bcere0013_55850dMKLETNLNVVDLTNEELEINGG-GSWANASVGAGTGASVAVGALKGAQKGASWGSRVGPWGLAAGAVAGAAIGGYLAYD56; 9.53
Clostridium perfringens SM101 peptide
    CPR_1081dMENLNLNQLENINGG-YWKTIWAVGPGLYQRDTETGKYRWIQTQDNLSYTTNVIANGWAGSAAGGYFSGR54; 9.23
L. acidophilus NCFM peptides
    LBA1791MNKFKDLNELELSNIAGG-SNNIFWTRVGVGWAAEARCMIKPSLGNWTTKAVSCGAKGLYAAVRG46; 10.06
    LBA1797cMEKLMVLNEEKLSYVIGG-GNPKVAHCASQIGRSTAWGAVSGAATGTAVGQAVGALGGALFGGSMGVIKGSAACVSYLTRHRHH65; 10.32
    LBA1800MKKKVVKKTVLKEKELTKVVGG-KKAPISGYVGRGLWENLSNIFKHHK25; 10.17
    LBA1802MKLRQEQLNRKELSQVIGG-RRDMILVALPHAVGPDGMPGSGRGGGAQMRAIGSIPPWRPNWWK40; 8.33
    LBA1803MQEWKKTTLSDNELIDVIGG-SAKSYIRRLGPDGGYGGRESKLIAMADMIRRRI33; 10.90
    LBA1805MKKLKVMNNGELEKVIGG-SLYEMKNSVPRLLGPDGMEGSMGGSTGGIQSFRHFPGFGR44; 11.83
L. casei BL23 peptides
    LCABL_25750MISKEVGITLKQHDLVLIQGG-AKRRNKPSGCIVSTIGGAVAGAAGLNPFTTVAGAAIGLSLCLSTNYIHPA50; 9.85
    LCABL_25760dMSYNYRQLDDFQLSGVSGG-KKKFDCAATFVTGITAGIGSGTITGLAGGPFGIIGGAVVGGNLGAVGSAIKCLGDGMQ58; 8.82
L. johnsonii NCC 533 peptide
    LJ0775bdMSKFQQLTPEDLMETKGG-KIYHATPWQICNSKTHKCWADNAAIARTCGRVIVNGWLQHGPWGAR46; 9.75
L. sakei 23K peptides
    LSA0564_adMERISEYKVLNNNVLAGVQGG-KKKKGGFFWHYFGDPIVSFGKGFIGY26; 9.88
    LSA0564_bdMNKKLDSFSSIEDDKLGLVIGG-RNNLAYGLGKLVRAGVDIGIAIGSKGRYKPRH32; 11.03
Leuconostoc mesenteroides ATCC 8293 peptides
    LEUM_0069dMEKLSEQELAKVSGG-FPLLPIVVPIIAGGATYVAKDAWNHLDQIRSGWRKAGNSKW41; 9.99
    LEUM_0070MDFKTQRNVLNSEKLMMISGG-STDDSWEGFGSGLHKTVNTVVYAGTTVARAHTRSHQRCFTGNKW44; 9.18
  • a The dash indicates the predicted proteolytic cleavage site immediately after the double-glycine leader sequence.

  • b Lengths and pIs of the mature peptides (after removal of the leader sequence) were calculated using the Expasy Compute pI/Mw tool (http://au.expasy.org/tools/pi_tool.html).

  • c The underlined sequence shows 100% identity to the bacteriocin acidocin J1132αβ, a two-peptide bacteriocin from L. acidophilus (46).

  • d Peptides displaying similarities with previously identified bacteriocins. Aflv_2615 and Aflv_2616 display 43.1% and 21.3% identity to peptides LF221B and LF221A of the bacteriocin acidocin LF221 from Lactobacillus gasseri (26), while Bcere0013_55850 displays 46.4% identity to the LF221B peptide. CPR_1081 is 33.3% identical to the class IIc lactococcal bacteriocin lactococcin A (21). LCABL_25760 displays 32.8% identity to thermophilin 13 from Streptococcus thermophilus (28). LJ0775_b is 32.6% identical with the class II sec-dependent bacteriocin hiracin JM79 from Enterococcus hirae (40). LSA0564_a and LSA0564_b are 50% and 25% identical to the β-peptide and α-peptide, respectively, of the two-peptide bacteriocin plantaricin S from L. plantarum (45). LEUM_0069 displays 34.1% identity with Orf4, a putative bacteriocin found in the plantaricin locus of L. plantarum J51 (31).