Table 1.

Sequences of the H. pylori CopA ATPase inserted into vector M0 or M1a

InsertsSequencePositionsGlycosylationbActivityc
M0M1
H1LALAVIFTLFVVYLSMGAMLSL84 to S104+SA, ST
H2HSNFLNACLQLIGTLIVMHLGRH118 to R139±SA, ST
H3LIAIGTSAALISSLWQLYLVYTL159 to T180+SA, ST
H4WSYGHYYFESVCVILMFVMVGRW183 to R205+SA, ST
HXaLVDSIVVGDILKVLPGSAIAVL241 to V261+
HXbNQQIEVLVDSIVVGDILKVLPGSAIAVDGN235 to G263+
H5VSSVFVPSVIAIAILAFVVWLIIAAV340 to A363+SA, ST
H6aFWWNFGIALEVFVSVLVISCPCALGLATPMSILF368 to L400±SA, ST
H6bFWWNFGIALEVFVSVLVISCPCALGLAF368 to A394±SA, ST
H6cFWWNFGIALEVFVSVLVIF368 to I385±SA, ST
H6dIALEVFVSVLVISCPCALGLATPMSILI374 to L400±SA, ST
H6eIALEVFVSVLVISCPCALGLAI374 to A394ST
H6fIALEVFVSVLVISI374 to I385±SA, ST
HYLNDAPSLAMSDVAVVMKL629 to K646+
H7NLFWAFCYNSVFIPLACGVLN684 to L703ST
H7aKENLFWAFCYNSVFIPLACGVLKAK682 to K705ST
H7bKENLFWAFCYNSVFIPLACGVLK682 to L705ST
H7cKNIKENLFWAFCYNSVFIPLACGVLK679 to L703ST
H7dKNIKENLFWAFCYNSVFIPLACGVLKAK679 to K705ST
H7eNLFWAFCYNSVFIPLACGVLKAN684 to K705ST
H8aIMLSPAIAGLAMSLSSVSVVLI708 to K728ST
H8bIMLSPAIAGLAMSLSSVSVVLNSQRLRNFKIKI708 to K739ST
HY-7LNDAPSLAMS/––––––––/VFIPLACGVL–L629 to L703±NDSAd
HY-8aLNDAPSLAMS/––––––––/MSLSSVSVVL–L629 to L728NDSAd
HY-8bLNDAPSLAMS/––––––––/SQRLRNFKIK–L629 to K739NDSAd
  • a In the fusion proteins, either HK-M0 or HK-M1 is followed by the listed copper ATPase insert sequences and the β-subunit segment. The last three columns present a summary of the results of all the different inserts expressed in the vectors HK-M0 (M0) and HK-M1 (M1).

  • b +, presence of glycosylation; −, absence of glycosylation; ±, variable glycosylation; ND, not determined.

  • c SA, signal anchor activity; ST, stop transfer activity.

  • d Stop transfer activity not determined.